Danio rerio (zebrafish): 100534937 Help Entry 100534937         CDS       T01004                                  Name (RefSeq) LOW QUALITY PROTEIN: insulin   KO K04526   insulin Organism dre  Danio rerio (zebrafish) Pathway dre04010   MAPK signaling pathway dre04068   FoxO signaling pathway dre04081   Hormone signaling dre04114   Oocyte meiosis dre04140   Autophagy - animal dre04150   mTOR signaling pathway dre04810   Regulation of actin cytoskeleton dre04910   Insulin signaling pathway dre04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100534937    04150 mTOR signaling pathway     100534937   09133 Signaling molecules and interaction    04081 Hormone signaling     100534937  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100534937  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dre04052]     100534937 Cytokines and neuropeptides [BR:dre04052]  Neuropeptides   Unclassified    100534937 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100534937 NCBI-ProteinID:  XP_009297891 UniProt:  A0A8M3AY64 LinkDB All DBs Position 3:32474445..32477059 Genome browser AA seq 113 aa AA seqDB search MQGSGLLLLSLCAGSLLTHSGAGGKRRLCGIQLVEALLIVCGEKGLFHQPWGKRVREHKL RKLPCSGERDAFEKRGIVEQCCHFSSAXDLENYCNTKKSPVLLLHILHLSNDN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcaggggtcgggtcttctgctgctgtctctgtgcgccggctctttgctgacccacagt ggcgcgggagggaagcggaggctgtgcgggattcagctcgtggaggcgctgctgatcgtc tgcggagagaagggtctcttccaccagccctgggggaagcgtgttcgagagcacaaactc cgtaagttaccatgcagtggagagagagacgcgtttgagaagaggggcattgtggagcag tgctgtcatttttcttctgcgnatgacctggagaattactgtaacacaaagaaatcacca gtgctacttctgcatatacttcacctgagtaatgataactag

DBGET integrated database retrieval system