Danio rerio (zebrafish): 140533 Help Entry 140533            CDS       T01004                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism dre  Danio rerio (zebrafish) Pathway dre00190   Oxidative phosphorylation dre01100   Metabolic pathways Module dre_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:dre00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     140533 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:dre03029]     140533 (ND3) Enzymes [BR:dre01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      140533 (ND3) Mitochondrial biogenesis [BR:dre03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     140533 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 Motif Other DBs NCBI-GeneID:  140533 NCBI-ProteinID:  NP_059338 ZFIN:  ZDB-GENE-011205-9 UniProt:  Q9MIY3 LinkDB All DBs Position MT:10590..10940 Genome browser AA seq 116 aa AA seqDB search MNLFATILIIMTTLSLVLALVSFWLPQMNSDTEKLSPYECGFDPLGSARLPFSLRFFLVA VLFPLFDLEIALLLPLPWGDQLNNPMETLFWAMTVLILLTLGLAYEWAQGGLEWAE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaatttatttgcaactattcttattattataacgaccttatcattggtcttagctcta gtatcattttgactaccacaaatgaactctgatacagaaaagctatcaccatatgaatgc ggatttgatccactagggtccgcccgcctaccattttcattacgatttttcttagtagca gttttattccctttatttgacttggaaattgctctcctattaccactcccatgaggagat caacttaataacccaatagaaactctcttttgagctataacagtactgattttgctaaca ctaggactagcctacgaatgagcccaaggcggccttgaatgagcagagtag

DBGET integrated database retrieval system