Danio rerio (zebrafish): 30380 Help Entry 30380             CDS       T01004                                  Symbol nraS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism dre  Danio rerio (zebrafish) Pathway dre04010   MAPK signaling pathway dre04012   ErbB signaling pathway dre04068   FoxO signaling pathway dre04137   Mitophagy - animal dre04140   Autophagy - animal dre04150   mTOR signaling pathway dre04210   Apoptosis dre04218   Cellular senescence dre04370   VEGF signaling pathway dre04371   Apelin signaling pathway dre04540   Gap junction dre04625   C-type lectin receptor signaling pathway dre04810   Regulation of actin cytoskeleton dre04910   Insulin signaling pathway dre04912   GnRH signaling pathway dre04916   Melanogenesis Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     30380 (nraS)    04012 ErbB signaling pathway     30380 (nraS)    04370 VEGF signaling pathway     30380 (nraS)    04371 Apelin signaling pathway     30380 (nraS)    04068 FoxO signaling pathway     30380 (nraS)    04150 mTOR signaling pathway     30380 (nraS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     30380 (nraS)    04137 Mitophagy - animal     30380 (nraS)   09143 Cell growth and death    04210 Apoptosis     30380 (nraS)    04218 Cellular senescence     30380 (nraS)   09144 Cellular community - eukaryotes    04540 Gap junction     30380 (nraS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     30380 (nraS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     30380 (nraS)   09152 Endocrine system    04910 Insulin signaling pathway     30380 (nraS)    04912 GnRH signaling pathway     30380 (nraS)    04916 Melanogenesis     30380 (nraS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     30380 (nraS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     30380 (nraS)    04031 GTP-binding proteins [BR:dre04031]     30380 (nraS) Membrane trafficking [BR:dre04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     30380 (nraS)  Endocytosis   Macropinocytosis    Ras GTPases     30380 (nraS) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    30380 (nraS)   Exosomal proteins of other body fluids (saliva and urine)    30380 (nraS)   Exosomal proteins of breast cancer cells    30380 (nraS)   Exosomal proteins of colorectal cancer cells    30380 (nraS) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     30380 (nraS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  30380 NCBI-ProteinID:  NP_571220 ZFIN:  ZDB-GENE-990415-166 Ensembl:  ENSDARG00000038225 UniProt:  Q6DGD1 LinkDB All DBs Position 8:complement(12690420..12707359) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggttgttgtgggagcaggaggtgttgggaagagcgcgttaaca atccagctcatccagaatcactttgtggatgaatatgaccccactattgaggactcttac aggaagcaggtggtgattgacggcgagacgtgtctgctggacatcctggacactgcaggc caggaagagtacagcgcaatgagagaccagtacatgaggacaggagagggtttcctctgc gtcttcgctatcaacaacagcaaatccttcgccgacgtgcatttgtacagagagcagatc aagcgtgtgaaggactcggatgatgttcccatggtcctagtggggaacaaatgtgatttg gcaaggactgtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt gtagaaacctctgccaaaaccagacagggagtcgaggatgctttctacacccttgtccgt gagatccggcattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system