Danio rerio (zebrafish): 321622 Help Entry 321622            CDS       T01004                                  Symbol hmgb1a Name (RefSeq) high mobility group protein B1a   KO K10802   high mobility group protein B1 Organism dre  Danio rerio (zebrafish) Pathway dre03410   Base excision repair dre04140   Autophagy - animal dre04217   Necroptosis Brite KEGG Orthology (KO) [BR:dre00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     321622 (hmgb1a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     321622 (hmgb1a)   09143 Cell growth and death    04217 Necroptosis     321622 (hmgb1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dre03036]     321622 (hmgb1a)    03400 DNA repair and recombination proteins [BR:dre03400]     321622 (hmgb1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     321622 (hmgb1a) Chromosome and associated proteins [BR:dre03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     321622 (hmgb1a) DNA repair and recombination proteins [BR:dre03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      321622 (hmgb1a)    MMR (mismatch excision repair)     Other MMR factors      321622 (hmgb1a) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    321622 (hmgb1a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  321622 NCBI-ProteinID:  NP_955849 ZFIN:  ZDB-GENE-030131-341 Ensembl:  ENSDARG00000099175 UniProt:  Q6NX86 LinkDB All DBs Position 10:36026580..36031374 Genome browser AA seq 205 aa AA seqDB search MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFE DMAKLDKARYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLS IGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRSKGKVGGGAAKAPSKPDK ANDEDEDDDEEEDEDDDDEEEEDDE NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggggaaggatccgacaaaaccaaggggcaaaatgtcctcttacgcatactttgtccag acttgccgagaggagcacaagaagaaacaccccgaggcgacggtcaacttttctgagttt tccaaaaagtgctcagagcgatggaagactatgtcagccaaagaaaaagggaagtttgaa gacatggccaaactggacaaggcacgttacgagagggagatgaagaactacattccaccc aaaggcgagaagaagaagaggtttaaggaccctaatgctcccaagagacccccgtctgcc ttcttcattttctgctccgagttccgacccaaggtgaaagaagagaccccgggtctgtct atcggagacgtggccaagagactgggtgagatgtggaacaaaatatcatctgaagagaag cagccgtacgagaagaaggccgccaagctgaaggagaagtacgagaaggacatcgctgcc tatcgctctaaaggcaaagtgggaggaggcgcagccaaagccccatccaagccagacaag gctaacgatgaggacgaagacgacgatgaagaggaggacgaagatgacgatgatgaagag gaggaggatgacgagtag

DBGET integrated database retrieval system