Danio rerio (zebrafish): 327026 Help Entry 327026            CDS       T01004                                  Symbol arf2b Name (RefSeq) ARF GTPase 2b   KO K07937   ADP-ribosylation factor 1/2 Organism dre  Danio rerio (zebrafish) Pathway dre04144   Endocytosis dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     327026 (arf2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     327026 (arf2b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     327026 (arf2b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     327026 (arf2b)    04031 GTP-binding proteins [BR:dre04031]     327026 (arf2b) Membrane trafficking [BR:dre04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     327026 (arf2b)   Arf GTPases and associated proteins    Arf GTPases     327026 (arf2b)  Endosome - Golgi transport     327026 (arf2b) Exosome [BR:dre04147]  Exosomal proteins   Proteins found in most exosomes    327026 (arf2b) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     327026 (arf2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Roc G-alpha Ras Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M cobW Motif Other DBs NCBI-GeneID:  327026 NCBI-ProteinID:  NP_958888 ZFIN:  ZDB-GENE-030131-5234 Ensembl:  ENSDARG00000016393 UniProt:  Q7ZUZ7 LinkDB All DBs Position 24:40137921..40145018 Genome browser AA seq 181 aa AA seqDB search MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHALRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaatgtctttgcgaacctgtttaagggtttattcgggaagaaggagatgagaatt ctcatggttggtctcgacgccgccggtaaaaccaccatcctgtataaactcaagctggga gaaatagttaccaccattcccactatcggttttaatgtagagacggtagagtataagaat atcagtttcacggtttgggatgttggtggccaagacaaaatcagaccactttggaggcac tatttccagaacactcaaggtttgatctttgtagtggacagtaatgacagagaacgagta aatgaagccagggaggagttgacgagaatgttagcagaagacgagttgcgggatgctgta cttctcgtttttgcaaacaaacaggaccttcccaacgccatgaacgcagctgagattaca gataaactgggtctccatgcactccgtcaccgtaactggtacatccaagccacctgcgcc accagtggagacgggctctacgaaggcctggactggctctccaatcagctgaagaaccag aaatga

DBGET integrated database retrieval system