Danio rerio (zebrafish): 378724 Help Entry 378724            CDS       T01004                                  Symbol arf5 Name (RefSeq) ADP-ribosylation factor 5   KO K07939   ADP-ribosylation factor 4 Organism dre  Danio rerio (zebrafish) Pathway dre04144   Endocytosis Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     378724 (arf5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     378724 (arf5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     378724 (arf5)    04031 GTP-binding proteins [BR:dre04031]     378724 (arf5) Membrane trafficking [BR:dre04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     378724 (arf5) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    378724 (arf5)   Exosomal proteins of other body fluids (saliva and urine)    378724 (arf5)   Exosomal proteins of colorectal cancer cells    378724 (arf5) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     378724 (arf5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K LepB_N SRP54 Motif Other DBs NCBI-GeneID:  378724 NCBI-ProteinID:  NP_954969 ZFIN:  ZDB-GENE-030910-5 Ensembl:  ENSDARG00000070472 UniProt:  Q7ZUW4 LinkDB All DBs Position 18:7543164..7553116 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFGRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVAESAEELSKMLQEDELRDAV LLVFANKQDLPNAMAVSELTDKLGLQSLRSRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggtttgaccatctcgtcgctctttgggagacttttcggcaagaaacagatgaggata ctgatggtgggtttggacgctgctggtaaaaccacaatactttacaagctgaagctggga gaaattgtcaccaccatccctactataggttttaatgtagagactgttgaatacaagaac atctgcttcactgtgtgggacgttggcggtcaggacaagattcgtcctctgtggagacac tattttcagaacacacagggtttgatctttgtggtggacagcaatgacagagagagagta gcagaatctgcagaggagctttctaaaatgttgcaggaagatgaactgagggacgccgtg cttctggtttttgcaaacaaacaggatctgcctaacgccatggctgtcagtgaactcaca gacaaactcggcctgcagagcctacgcagcagaacgtggtacgttcaagcgacctgcgca acacagggcactggactctatgaaggactggactggttatcaaatgagctctccaaacgc tag

DBGET integrated database retrieval system