Danio rerio (zebrafish): 405821 Help Entry 405821            CDS       T01004                                  Symbol rab5b Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism dre  Danio rerio (zebrafish) Pathway dre04137   Mitophagy - animal dre04144   Endocytosis dre04145   Phagosome dre04148   Efferocytosis dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     405821 (rab5b)    04145 Phagosome     405821 (rab5b)    04137 Mitophagy - animal     405821 (rab5b)    04148 Efferocytosis     405821 (rab5b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     405821 (rab5b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     405821 (rab5b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     405821 (rab5b)    04031 GTP-binding proteins [BR:dre04031]     405821 (rab5b) Membrane trafficking [BR:dre04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     405821 (rab5b)  Endosome - Lysosome transport     405821 (rab5b) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    405821 (rab5b)   Exosomal proteins of other body fluids (saliva and urine)    405821 (rab5b)   Exosomal proteins of colorectal cancer cells    405821 (rab5b)   Exosomal proteins of melanoma cells    405821 (rab5b) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     405821 (rab5b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA RsgA_GTPase MMR_HSR1 SDR-like AAA_16 Tfb2_C Motif Other DBs NCBI-GeneID:  405821 NCBI-ProteinID:  NP_998050 ZFIN:  ZDB-GENE-040426-2593 Ensembl:  ENSDARG00000016059 UniProt:  Q6NYD6 LinkDB All DBs Position 9:29423892..29450012 Genome browser AA seq 214 aa AA seqDB search MSTRGTGRANGNLPQTKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFERAKAWVKELQR QASPNIVIALAGNKADLADKRLVEYEEAQTYAEDTGLLFMETSAKTAMNVNELFLAIAKK MPKTDTQNPTHAARHRGVNLQDPDAQSTRSCCGN NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgagtacccgtgggacaggcagggccaatgggaacctaccgcagaccaagatctgccag tttaaactggtgctgctgggagacatggccgtcggcaagtccagcctggtgctgcgcttt gtgaagggacagtttgatgagtttcaggagaccaccattggagctgcattcttggcccag tctgtttgtctggacgacactacagtgaagtttgagatttgggacacagccggacaagag cgctaccacagcttggctcccatgtactaccgtggagcccaggcagccattgtagtgttt gatatcactaaacctgaaacatttgagcgagcaaaagcatgggtgaaagagctgcagcgg caggccagtcccaacatagtcattgctcttgcaggaaacaaagccgatctagcagacaag agacttgtggagtatgaggaagcccagacatatgcagaagacacaggtttactgttcatg gaaacctctgccaagactgcaatgaatgtaaacgagttgttcctggccattgcaaaaaag atgccaaaaacagacacccaaaaccctacgcatgctgcgcgacacaggggcgtgaacctg caggacccagacgcacagtccactcgaagctgctgtgggaactaa

DBGET integrated database retrieval system