Danio rerio (zebrafish): 406276 Help Entry 406276            CDS       T01004                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism dre  Danio rerio (zebrafish) Pathway dre04382   Cornified envelope formation dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     406276 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     406276 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     406276 (s100a10b) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of microglial cells    406276 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 Bcl-2 EH Motif Other DBs NCBI-GeneID:  406276 NCBI-ProteinID:  NP_998168 ZFIN:  ZDB-GENE-040426-1937 Ensembl:  ENSDARG00000025254 UniProt:  Q7ZVA4 LinkDB All DBs Position 16:23397785..23399285 Genome browser AA seq 100 aa AA seqDB search MPSDLERAMETLITVFHRYSGAEGNSSTLSRRELKQLMEKELASFLKSQKDPAAVDKIMK DLDANGDGEVNFEEFVSLVVGLSIACEQLYQKQMKAAAKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccatctgatctggagagagcaatggagaccctgatcacggtgtttcaccgttattca ggcgcagaggggaactcatcaaccctgagtcgaagagagcttaaacagctgatggagaaa gagctggctagttttctgaagagtcagaaagaccctgctgccgtagacaagattatgaag gatctggatgccaatggggatggagaggtgaattttgaggagtttgtgtctcttgtggtg ggcctgtccatcgcctgcgaacaactctaccagaaacagatgaaagcagcagccaagaag taa

DBGET integrated database retrieval system