Danio rerio (zebrafish): 415187 Help Entry 415187            CDS       T01004                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism dre  Danio rerio (zebrafish) Pathway dre04810   Regulation of actin cytoskeleton dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     415187 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     415187 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  415187 NCBI-ProteinID:  NP_001002097 ZFIN:  ZDB-GENE-040625-77 Ensembl:  ENSDARG00000041974 UniProt:  Q6IQ86 A8WG56 LinkDB All DBs Position 11:complement(36042271..36046480) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggacaggaggatccagtgcaaagggagattcaccaagattgggcaaatcgagaa tatatcgaagtgatcaccagcagcattaagaaaatagccgatttcctcaattccttcgat atgtcctgcaggtctcgtttagccactttgaatgagaagctcactgctttggagaggagg atcgagtacatcgaagccagagtcacaaaaggggaaaccctgacttag

DBGET integrated database retrieval system