Danio rerio (zebrafish): 449549 Help Entry 449549            CDS       T01004                                  Symbol zgc:100918 Name (RefSeq) Ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism dre  Danio rerio (zebrafish) Pathway dre04137   Mitophagy - animal dre04140   Autophagy - animal dre04144   Endocytosis dre04145   Phagosome dre04148   Efferocytosis dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     449549 (zgc:100918)    04145 Phagosome     449549 (zgc:100918)    04140 Autophagy - animal     449549 (zgc:100918)    04137 Mitophagy - animal     449549 (zgc:100918)    04148 Efferocytosis     449549 (zgc:100918)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     449549 (zgc:100918)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     449549 (zgc:100918)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     449549 (zgc:100918)    04031 GTP-binding proteins [BR:dre04031]     449549 (zgc:100918) Membrane trafficking [BR:dre04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     449549 (zgc:100918) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    449549 (zgc:100918)   Exosomal proteins of other body fluids (saliva and urine)    449549 (zgc:100918)   Exosomal proteins of colorectal cancer cells    449549 (zgc:100918)   Exosomal proteins of bladder cancer cells    449549 (zgc:100918) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     449549 (zgc:100918) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 AAA_22 NTPase_1 AAA_7 AAA_24 G-alpha AAA_5 DUF5992 SRPRB ATPase_2 ABC_tran NB-ARC NACHT AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  449549 NCBI-ProteinID:  NP_001005591 ZFIN:  ZDB-GENE-040927-2 Ensembl:  ENSDARG00000087243 UniProt:  Q641M4 LinkDB All DBs Position 10:complement(47990878..48004731) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPVSSGDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaagaaggtgctgctgaaggtgatcattctgggggattctggtgttggg aaaacctctctgatgaaccagtatgtcaacaagaagttcagcaatcagtataaagccacc atcggcgcagactttcttaccaaggaggtgatggtggacgacagactggtgacgatgcag atctgggatacggcaggacaggagcgtttccagtctctcggggtggcgttttaccgtggt gctgactgctgtgttctggtgtacgatgtgaccgcgcctaacaccttcaagactctggac agctggagggacgagttcctgattcaggccagtcctcgagacccggagaacttccccttc gtggtgctcggaaacaagatcgacttggagaacagacaggtgacgacgaaacgagcccag gcgtggtgtcagagcaaaagcaatatcccgtactttgaaaccagcgcaaaagaggccatc aatgtggaccaagctttccaaaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtacgatttccctgaccagatcaaactgcgagacgacagacctgtgtcctccggt gatggctgcagctgctga

DBGET integrated database retrieval system