Danio rerio (zebrafish): 449788 Help Entry 449788            CDS       T01004                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism dre  Danio rerio (zebrafish) Pathway dre04382   Cornified envelope formation dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     449788 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     449788 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     449788 (s100a10a) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of microglial cells    449788 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH Motif Other DBs NCBI-GeneID:  449788 NCBI-ProteinID:  NP_001005961 ZFIN:  ZDB-GENE-041010-35 Ensembl:  ENSDARG00000037425 UniProt:  Q5XJJ5 LinkDB All DBs Position 19:8606883..8608273 Genome browser AA seq 102 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGRSGTLTRRELRILMENELSGFLKSQKDPTFVDRIMK DLDANGDGEVDFEEFVSLVLGLSIACEACYRVDLRKSQSWNL NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgccatccgaactagagaccgccatggagtccctcatcatggttttccaccgatatgct ggaaaggagggcaggagcggcaccctgacccgacgggaactccgaatactaatggagaac gagctctctgggttccttaagtctcagaaggatccgacattcgtcgacagaattatgaaa gatctggatgccaatggagacggcgaggttgactttgaggagtttgtgtctttggtcttg ggtttgtccatcgcctgcgaggcttgctacagggtggatttaaggaagtcacaaagctgg aacctttga

DBGET integrated database retrieval system