Danio rerio (zebrafish): 550513 Help Entry 550513            CDS       T01004                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism dre  Danio rerio (zebrafish) Pathway dre04010   MAPK signaling pathway dre04137   Mitophagy - animal dre04140   Autophagy - animal dre04218   Cellular senescence dre04371   Apelin signaling pathway dre04625   C-type lectin receptor signaling pathway dre04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     550513 (rras2)    04371 Apelin signaling pathway     550513 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     550513 (rras2)    04137 Mitophagy - animal     550513 (rras2)   09143 Cell growth and death    04218 Cellular senescence     550513 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     550513 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     550513 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     550513 (rras2)    04031 GTP-binding proteins [BR:dre04031]     550513 (rras2) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    550513 (rras2)   Exosomal proteins of bladder cancer cells    550513 (rras2) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     550513 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase CTD10 Motif Other DBs NCBI-GeneID:  550513 NCBI-ProteinID:  NP_001017815 ZFIN:  ZDB-GENE-050417-352 Ensembl:  ENSDARG00000036252 UniProt:  Q568M0 LinkDB All DBs Position 7:27860293..27908791 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLEQQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcagtgcaggagaaatatcgcctggtggtcgtcggaggt ggtggcgtcggaaaatcagcgttaaccatccagtttatccagtcatacttcgtcactgac tatgaccccacgattgaagactcgtacacaaagcagtgtgtgattgacgagaggcctgca cggctggatatcctggatacagcaggacaggaagagttcggagccatgagagaacaatac atgaggacaggggagggtttccttctggtcttctctgtcaccgaccggggaagttttgaa gagatctacaagtttcaacggcagatcttgagagtgaaggaccgagatgaatttcccatg attctagttggtaacaaagctgatcttgagcaacagagacaagtgacccaagaggaagga cagcagctcgctcgacaactcaaagtcacatacatggaggcctcagctaaaatccggatg aatgtagaccaggctttccacgaactggtccgagtcataaggaagttccaggagcaggag tgtccaccttcaccagagcccacgcgcaaagaaaaggacaagagtggctgccactgcgtg atcttctga

DBGET integrated database retrieval system