Danio rerio (zebrafish): 557209 Help Entry 557209            CDS       T01004                                  Symbol cldn18 Name (RefSeq) claudin-18   KO K06087   claudin Organism dre  Danio rerio (zebrafish) Pathway dre03272   Virion - Hepatitis viruses dre04382   Cornified envelope formation dre04514   Cell adhesion molecules dre04530   Tight junction Brite KEGG Orthology (KO) [BR:dre00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     557209 (cldn18)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     557209 (cldn18)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     557209 (cldn18)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     557209 (cldn18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dre03037]     557209 (cldn18)    04147 Exosome [BR:dre04147]     557209 (cldn18)    04515 Cell adhesion molecules [BR:dre04515]     557209 (cldn18) Cilium and associated proteins [BR:dre03037]  Other cilia and associated proteins   Stereociliary proteins    557209 (cldn18) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    557209 (cldn18)   Exosomal proteins of colorectal cancer cells    557209 (cldn18) Cell adhesion molecules [BR:dre04515]  Immunoglobulin superfamily   L1 family    557209 (cldn18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Amastin DUF4064 Claudin_2 WTF Motif Other DBs NCBI-GeneID:  557209 NCBI-ProteinID:  XP_002660862 ZFIN:  ZDB-GENE-130530-867 UniProt:  A0A0G2L7R9 A0AB40EBY6 LinkDB All DBs Position 2:complement(22567289..22569540) Genome browser AA seq 133 aa AA seqDB search MSAPALQTTGFVSGVIGTAGVFAATLMDVWCFRNQQQDQPQRVSSIYTYKGLWKDCEMSG TVFPECQPLYSHPNYSGILQAARALMIIAILVAVIAVFIGFFCLKCLKMKNMQLSTRAKL ILSSAIIFFIAGI NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgagtgccccagctctgcagaccacaggcttcgtttcaggcgtcatcgggacggctggt gtttttgcagccaccctgatggacgtctggtgtttcagaaaccagcaacaggatcagccc caaagggtcagctccatctacacttataagggtctgtggaaggactgtgagatgtccggg actgtattccctgagtgccagcctctctacagccatcccaactactcaggaatactccag gctgcaagagctctgatgataatagcgattttagtggctgtgatcgcagtgttcatcggg tttttctgcttgaagtgcctcaaaatgaaaaatatgcagctttccaccagggccaaactc atcctaagttctgcgatcattttcttcattgctggtatataa

DBGET integrated database retrieval system