Danio rerio (zebrafish): 566735 Help Entry 566735            CDS       T01004                                  Symbol insB Name (RefSeq) preproinsulin b precursor   KO K04526   insulin Organism dre  Danio rerio (zebrafish) Pathway dre04010   MAPK signaling pathway dre04068   FoxO signaling pathway dre04081   Hormone signaling dre04114   Oocyte meiosis dre04140   Autophagy - animal dre04150   mTOR signaling pathway dre04810   Regulation of actin cytoskeleton dre04910   Insulin signaling pathway dre04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     566735 (insB)    04068 FoxO signaling pathway     566735 (insB)    04150 mTOR signaling pathway     566735 (insB)   09133 Signaling molecules and interaction    04081 Hormone signaling     566735 (insB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     566735 (insB)   09143 Cell growth and death    04114 Oocyte meiosis     566735 (insB)   09142 Cell motility    04810 Regulation of actin cytoskeleton     566735 (insB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     566735 (insB)    04914 Progesterone-mediated oocyte maturation     566735 (insB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dre04052]     566735 (insB) Cytokines and neuropeptides [BR:dre04052]  Neuropeptides   Unclassified    566735 (insB) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  566735 NCBI-ProteinID:  NP_001034153 ZFIN:  ZDB-GENE-040113-2 Ensembl:  ENSDARG00000034610 UniProt:  Q2QAJ9 LinkDB All DBs Position 14:complement(32889794..32894800) Genome browser AA seq 107 aa AA seqDB search MVLLLQASVLILLLASLPGSQSSPSQHLCGSSLVDALYLVCGPRGFFYTNRGRRDLETLL ALLSNLAGYEAADADPLKEKVMKMKRGIVEQCCHRPCTIYHLEDYCS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtcctgttgctgcaggcgtcagtattaatcctgctgctggcgtctctgcctggatca cagtcttctccatcccagcatctgtgtggttcaagcctggtggatgcgctttacctagtg tgtgggcctagaggtttcttctacacaaacagaggcaggagagacctggagaccttgctg gctttgctctcaaatttagcaggttatgaggcagcagatgcggatccgctgaaagagaag gtgatgaagatgaagagggggattgtggagcaatgctgccacaggccctgcaccatctac cacctggaggactactgcagctga

DBGET integrated database retrieval system