Danio rerio (zebrafish): 567192 Help Entry 567192            CDS       T01004                                  Symbol cd59a Name (RefSeq) CD59 glycoprotein precursor   KO K04008   CD59 antigen Organism dre  Danio rerio (zebrafish) Brite KEGG Orthology (KO) [BR:dre00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     567192 (cd59a)    04090 CD molecules [BR:dre04090]     567192 (cd59a)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]     567192 (cd59a) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    567192 (cd59a)   Exosomal proteins of other body fluids (saliva and urine)    567192 (cd59a)   Exosomal proteins of colorectal cancer cells    567192 (cd59a) CD molecules [BR:dre04090]  Proteins   567192 (cd59a) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]  Antigens   567192 (cd59a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Activin_recp Motif Other DBs NCBI-GeneID:  567192 NCBI-ProteinID:  NP_001313314 ZFIN:  ZDB-GENE-030131-7871 Ensembl:  ENSDARG00000090615 UniProt:  E7F2M5 LinkDB All DBs Position 7:complement(38911598..38914487) Genome browser AA seq 118 aa AA seqDB search MKASVGVCVVFVLALLGLGSAIKCYNCKDYTGACSKIKDCYYDDACLSVYERGGDTYRQC IKYSECDYSTVGVKFPKLSSFKFSCCTSDLCNSAPLSVSSRSVVAILLPLALFWWGVF NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaaagcttctgtcggagtgtgtgtggttttcgtgctggctctgctggggcttggttct gccattaaatgttacaattgtaaggactacacaggcgcatgctctaaaattaaagactgc tactatgatgatgcctgcttgtctgtctacgagagaggtggcgacacatacaggcagtgt ataaagtactctgaatgcgattatagcacagtcggcgtgaagtttcctaaactttccagc tttaaattctcctgctgtacctctgacctgtgtaactcagcacccctgtcggtgtccagt cgctctgtggtggcgatactgctcccgttagcactcttctggtggggtgttttctaa

DBGET integrated database retrieval system