Danio rerio (zebrafish): 570965 Help Entry 570965            CDS       T01004                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism dre  Danio rerio (zebrafish) Pathway dre04068   FoxO signaling pathway dre04136   Autophagy - other dre04140   Autophagy - animal dre04621   NOD-like receptor signaling pathway dre04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     570965 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     570965 (atg12)    04136 Autophagy - other     570965 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     570965 (atg12)    04622 RIG-I-like receptor signaling pathway     570965 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     570965 (atg12)    04121 Ubiquitin system [BR:dre04121]     570965 (atg12)    03029 Mitochondrial biogenesis [BR:dre03029]     570965 (atg12) Membrane trafficking [BR:dre04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     570965 (atg12) Ubiquitin system [BR:dre04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    570965 (atg12) Mitochondrial biogenesis [BR:dre03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     570965 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Thioredoxin_15 Motif Other DBs NCBI-GeneID:  570965 NCBI-ProteinID:  NP_001233129 ZFIN:  ZDB-GENE-071205-7 Ensembl:  ENSDARG00000069545 UniProt:  F5ATB4 LinkDB All DBs Position 16:13883934..13888546 Genome browser AA seq 120 aa AA seqDB search MSDNAESPTENPKDEHSLQHAVTDHSESSDEKKKIDVLLKAVGVTPIMKTKKWSVERRRT IQSLAQFISRFLKLEPSEQLFIYVNQSFAPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagaatctcctacagaaaacccgaaagatgaacattcgcttcagcac gctgtcacagatcactctgagtcatcggacgagaagaaaaagattgatgtgcttttaaag gcggtcggtgtcacacccatcatgaagaccaaaaaatggtctgtggagagaaggaggacg atacagtcactcgcccagttcatctcacgcttcctcaagctggagcccagcgaacagttg tttatttatgttaatcagtcgtttgcgccatcaccggaccaagaagttggtgtgcttttt gagtgtttcggaagtgacggcaaactagttcttcattactgcaagtctcaggcctgggga tga

DBGET integrated database retrieval system