Danio rerio (zebrafish): 571897 Help Entry 571897            CDS       T01004                                  Symbol rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism dre  Danio rerio (zebrafish) Pathway dre04140   Autophagy - animal dre04144   Endocytosis dre04530   Tight junction Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     571897 (rab8a)    04140 Autophagy - animal     571897 (rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     571897 (rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     571897 (rab8a)    03036 Chromosome and associated proteins [BR:dre03036]     571897 (rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     571897 (rab8a)    04031 GTP-binding proteins [BR:dre04031]     571897 (rab8a) Membrane trafficking [BR:dre04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     571897 (rab8a)  Autophagy   Other autophagy associated proteins     571897 (rab8a) Chromosome and associated proteins [BR:dre03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     571897 (rab8a) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    571897 (rab8a)   Exosomal proteins of other body fluids (saliva and urine)    571897 (rab8a)   Exosomal proteins of colorectal cancer cells    571897 (rab8a) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     571897 (rab8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 Tor_FN3_2nd AAA_7 Motif Other DBs NCBI-GeneID:  571897 NCBI-ProteinID:  NP_001083031 ZFIN:  ZDB-GENE-070424-36 Ensembl:  ENSDARG00000067920 UniProt:  A4FVK4 LinkDB All DBs Position 2:complement(55273240..55298085) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILG NKCDINEKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGN NPQGSNHGVKITTEQPKKSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattatttgtttaaactgctgttaatcggggattccggagtcggg aagacctgtgtgctgttcagattctcagaggatgcctttaactcgacatttatctcgacg ataggtatcgatttcaagatcaggacaatagaactagatggcaagaagataaagttacag atatgggacacggcaggacaggaacgatttcggacgatcacgacagcatattacagaggt gcaatgggtattatgctggtttatgatatcaccaatgagaagtcatttgacaacatcaaa aactggatccgaaacatagaggagcatgcatcagctgatgtggaaaagatgattttgggg aacaaatgtgacattaatgagaagaggcaggtgtctaaagacagaggcgagaagctggcg ttagagtacggcatcaagttcatggagacaagtgcaaaggctaatatcaacgttgagaat gctttcttaacactcgccagagacataaaagcaaagatggacacaaaattggagggaaac aatcctcagggcagcaaccacggtgtgaaaattaccactgaacagccgaaaaagagcagc ttctttcgctgtgtgctactgtga

DBGET integrated database retrieval system