Danio rerio (zebrafish): 572690 Help Entry 572690            CDS       T01004                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism dre  Danio rerio (zebrafish) Pathway dre04517   IgSF CAM signaling dre04814   Motor proteins dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     572690 (dynll2b)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     572690 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     572690 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dre03037]     572690 (dynll2b)    04812 Cytoskeleton proteins [BR:dre04812]     572690 (dynll2b) Cilium and associated proteins [BR:dre03037]  Motile cilia and associated proteins   Dynein arm    572690 (dynll2b) Cytoskeleton proteins [BR:dre04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      572690 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  572690 NCBI-ProteinID:  NP_001025171 ZFIN:  ZDB-GENE-050320-132 Ensembl:  ENSDARG00000005172 UniProt:  Q5BL99 LinkDB All DBs Position 21:complement(42835272..42843979) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaatgctgatatgtctgaggacatgcagcaggat gcagtggattgtgccacacaggctatggagaagtacaacatcgagaaggacattgctgca tatatcaaaaaggagttcgataagaagtacaatcccacatggcattgtattgtgggacgg aactttggcagttacgtgacgcacgaaacgaagcatttcatctacttttacttgggtcag gtggccatcctgctctttaaatcgggctga

DBGET integrated database retrieval system