Danio rerio (zebrafish): 572690 Help Entry 572690            CDS       T01004                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism dre  Danio rerio (zebrafish) Pathway dre04814   Motor proteins dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     572690 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     572690 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dre03037]     572690 (dynll2b)    04812 Cytoskeleton proteins [BR:dre04812]     572690 (dynll2b) Cilium and associated proteins [BR:dre03037]  Motile cilia and associated proteins   Dynein arm    572690 (dynll2b) Cytoskeleton proteins [BR:dre04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      572690 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  572690 NCBI-ProteinID:  NP_001025171 ZFIN:  ZDB-GENE-050320-132 Ensembl:  ENSDARG00000005172 UniProt:  Q5BL99 LinkDB All DBs Position 21:complement(42835272..42843979) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaatgctgatatgtctgaggacatgcagcaggat gcagtggattgtgccacacaggctatggagaagtacaacatcgagaaggacattgctgca tatatcaaaaaggagttcgataagaagtacaatcccacatggcattgtattgtgggacgg aactttggcagttacgtgacgcacgaaacgaagcatttcatctacttttacttgggtcag gtggccatcctgctctttaaatcgggctga

DBGET integrated database retrieval system