Danio rerio (zebrafish): 793158 Help Entry 793158            CDS       T01004                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism dre  Danio rerio (zebrafish) Pathway dre04010   MAPK signaling pathway dre04144   Endocytosis dre04370   VEGF signaling pathway dre04510   Focal adhesion dre04520   Adherens junction dre04530   Tight junction dre04810   Regulation of actin cytoskeleton dre04912   GnRH signaling pathway dre05100   Bacterial invasion of epithelial cells dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     793158 (cdc42l)    04370 VEGF signaling pathway     793158 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     793158 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     793158 (cdc42l)    04520 Adherens junction     793158 (cdc42l)    04530 Tight junction     793158 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     793158 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     793158 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     793158 (cdc42l)    05100 Bacterial invasion of epithelial cells     793158 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     793158 (cdc42l)    03036 Chromosome and associated proteins [BR:dre03036]     793158 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     793158 (cdc42l)    04031 GTP-binding proteins [BR:dre04031]     793158 (cdc42l) Membrane trafficking [BR:dre04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     793158 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     793158 (cdc42l)   Macropinocytosis    Ras GTPases     793158 (cdc42l) Chromosome and associated proteins [BR:dre03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     793158 (cdc42l) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of microglial cells    793158 (cdc42l)   Exosomal proteins of breast milk    793158 (cdc42l) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     793158 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  793158 NCBI-ProteinID:  NP_956159 ZFIN:  ZDB-GENE-030131-6069 Ensembl:  ENSDARG00000040158 UniProt:  Q7ZUQ1 LinkDB All DBs Position 16:complement(31815244..31824502) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLSRDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaaatgtgtggtggttggggatggagctgtcggaaagacctgtctgctc atctcatatacaaccaacaaattcccctccgaatatgttcctacggtgttcgataattat gctgtcacggtgatgattggaggggaaccgtatacactggggcttttcgacacagcaggg caggaagactacgacagacttcggcctctcagttatccgcagacagacgtcttccttgtc tgcttctcagttgtttctccttcctcctttgagaatgtgaaagagaagtgggtaccagag atctctcaccattgtccacgcactccattccttcttgtgggcactcaggtggacctgagg gatgacagtaacactgtggaaaaacttgccaaaaacaagcagcgccccatatcacccgag agtggggagaagctgtccagagacctcagagctgtcaaatacgtggagtgctccgctctc acacagagaggcttgaagaacgtattcgacgaggcaattctcgccgcccttgaacctcct gagaccaaacccaagaagcgctgcgtccttttgtag

DBGET integrated database retrieval system