Danio rerio (zebrafish): 795095 Help Entry 795095            CDS       T01004                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism dre  Danio rerio (zebrafish) Pathway dre03410   Base excision repair dre04140   Autophagy - animal dre04217   Necroptosis Brite KEGG Orthology (KO) [BR:dre00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     795095 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     795095 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     795095 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dre03036]     795095 (hmgb1b)    03400 DNA repair and recombination proteins [BR:dre03400]     795095 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     795095 (hmgb1b) Chromosome and associated proteins [BR:dre03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     795095 (hmgb1b) DNA repair and recombination proteins [BR:dre03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      795095 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      795095 (hmgb1b) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    795095 (hmgb1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  795095 NCBI-ProteinID:  NP_001092721 ZFIN:  ZDB-GENE-030131-8480 Ensembl:  ENSDARG00000030479 UniProt:  X1WFI9 LinkDB All DBs Position 15:complement(31513065..31516568) Genome browser AA seq 197 aa AA seqDB search MGKDPRKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFE DMAKQDKVRYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLS IGDIAKKLGEMWNSSSAEVKQPYEKKAAKLKEKYDKDIALYRTKGIAGFSKKEGGEDDEE DEDDDEEEDDEEEEDDE NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgggtaaagatccaaggaagcccagaggaaagatgtcctcttatgcctactttgtgcaa acctgtcgtgaggagcacaaaaagaagcaccctgaagccagtgtgaacttctctgaattc tccaagaagtgttcagagcgatggaagacaatgtctgccaaagagaagggcaagtttgag gatatggccaagcaagataaggttcgctatgagagggaaatgaagaactacatcccacca aagggtgagaagaagaagaggtttaaggatcccaacgcacccaagagaccaccgtcagcg ttcttcattttctgtggtgattaccgccctaagataaagggtgaaaaccctggtctgtcc atcggcgacattgccaaaaagcttggagaaatgtggaacagctcatcagctgaagtgaag cagccctatgaaaagaaagccgcaaagctcaaggagaagtacgacaaggatattgccctg taccgcacaaagggaattgcaggcttttcaaagaaagaaggtggggaggatgatgaggag gatgaagacgacgatgaggaggaggacgacgaagaggaggaggatgatgagtag

DBGET integrated database retrieval system