Danio rerio (zebrafish): 796314 Help Entry 796314            CDS       T01004                                  Symbol cldn28 Name (RefSeq) claudin-like protein ZF-A89   KO K06087   claudin Organism dre  Danio rerio (zebrafish) Pathway dre03272   Virion - Hepatitis viruses dre04382   Cornified envelope formation dre04514   Cell adhesion molecules dre04530   Tight junction Brite KEGG Orthology (KO) [BR:dre00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     796314 (cldn28)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     796314 (cldn28)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     796314 (cldn28)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     796314 (cldn28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dre03037]     796314 (cldn28)    04147 Exosome [BR:dre04147]     796314 (cldn28)    04515 Cell adhesion molecules [BR:dre04515]     796314 (cldn28) Cilium and associated proteins [BR:dre03037]  Other cilia and associated proteins   Stereociliary proteins    796314 (cldn28) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    796314 (cldn28)   Exosomal proteins of colorectal cancer cells    796314 (cldn28) Cell adhesion molecules [BR:dre04515]  Immunoglobulin superfamily   L1 family    796314 (cldn28) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF1129 Motif Other DBs NCBI-GeneID:  796314 NCBI-ProteinID:  XP_005161336 ZFIN:  ZDB-GENE-201223-1 UniProt:  A0A8M2B8H5 LinkDB All DBs Position 21:25789030..25790150 Genome browser AA seq 189 aa AA seqDB search MRTRQFVAAFLALVGLCGTILICALPMWKVSAFVGANIVTAQVYWQGLWMNCVLQSTGHM QCMAYYSVLALTQDLQAARGLICASIGVSAIAFGMMVVGANCTRFYREDQLKKTNIGISA GALYIVGGVMCLVAVCWQTSIIVMNFYNPQVIAGTQGELGACIYIGWVAGFLLIIGGGLL LSTYSNRCC NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaggacacgacagttcgtggctgcatttctggctttggttggcctgtgcgggaccatc ctgatttgtgccttgcctatgtggaaagtgtcggcctttgtcggagcgaacattgtgact gcacaggtctactggcaaggcttgtggatgaactgcgtcttgcaaagcactggccacatg cagtgcatggcgtattactctgttctggcactgactcaagatctccaggccgctcgtggt ttgatttgtgcttctatcggtgtcagtgcaattgcctttggaatgatggttgttggggcc aattgtacacggttttacagagaagatcaacttaaaaagaccaacattggaatatcagct ggcgcattgtatatagttggaggtgtaatgtgccttgttgctgtctgctggcagacgtct attattgtcatgaacttttataatcctcaagtaatagcagggacacaaggagagctggga gcctgcatctatataggatgggtcgctggatttttgctaattattggcggtggactgctt ttaagcacatactccaaccgatgttgttga

DBGET integrated database retrieval system