Danio rerio (zebrafish): 798375 Help Entry 798375            CDS       T01004                                  Symbol aplN Name (RefSeq) apelin precursor   KO K05225   apelin Organism dre  Danio rerio (zebrafish) Pathway dre04080   Neuroactive ligand-receptor interaction dre04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     798375 (aplN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     798375 (aplN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dre04052]     798375 (aplN) Cytokines and neuropeptides [BR:dre04052]  Neuropeptides   GPCR binding    798375 (aplN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  798375 NCBI-ProteinID:  NP_001159596 ZFIN:  ZDB-GENE-070521-8 Ensembl:  ENSDARG00000053279 UniProt:  Q4TTN8 LinkDB All DBs Position 14:38302360..38336787 Genome browser AA seq 77 aa AA seqDB search MNVKILTLVIVLVVSLLCSASAGPMASTEHSKEIEEVGSMRTPLRQNPARAGRSQRPAGW RRRRPRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcttgacgctggtgattgtgctggtggtttctctgctgtgttcagcc agtgctggtccaatggcctccaccgagcatagcaaagagatcgaggaggtgggaagcatg aggactcctttgcggcagaatcccgctcgagctggccggagccaaagacccgctggctgg aggaggagacgccctcgaccccgcctctcccataaggggcccatgccattctag

DBGET integrated database retrieval system