Danio rerio (zebrafish): 798632 Help Entry 798632            CDS       T01004                                  Symbol myl6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism dre  Danio rerio (zebrafish) Pathway dre04270   Vascular smooth muscle contraction dre04530   Tight junction dre04814   Motor proteins Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     798632 (myl6)   09142 Cell motility    04814 Motor proteins     798632 (myl6)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     798632 (myl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dre04812]     798632 (myl6)    04147 Exosome [BR:dre04147]     798632 (myl6) Cytoskeleton proteins [BR:dre04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      798632 (myl6) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    798632 (myl6)   Exosomal proteins of bladder cancer cells    798632 (myl6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 AIF-1 EF-hand_9 EF-hand_5 Motif Other DBs NCBI-GeneID:  798632 NCBI-ProteinID:  NP_001005955 ZFIN:  ZDB-GENE-041010-28 Ensembl:  ENSDARG00000008494 UniProt:  Q5XJ62 LinkDB All DBs Position 6:complement(39874177..39893581) Genome browser AA seq 151 aa AA seqDB search MSDFTEDQICEFKEAFLLFDRTGDGKIMYNQCGDVMRALGQNPVNAEVLKVLGNPSNEDM NMKMLDFEQFLPMLQAIAKNKDQGSFEDFVEGLRVFDKEGNGTVMGAELRHVLTTLGEKM TEEEVETLLAGHEDANGCINYEAFVRHIMAG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgacttcacggaggaccagatttgtgaatttaaggaggccttccttctgtttgac cgaacaggagatgggaagatcatgtacaatcagtgtggggatgtgatgcgagctctcggc cagaaccctgtcaatgctgaggtccttaaagtcctgggcaaccccagtaatgaagatatg aacatgaagatgctggactttgagcagtttctgccaatgctgcaggccattgctaagaac aaggatcagggctcctttgaggactttgtggagggactgcgggtctttgacaaagaggga aatgggacggtgatgggtgctgagttgcgacatgtcctcactacactaggtgagaagatg acagaggaagaggtggagacgctcttagcaggacacgaggacgctaacggttgcatcaat tatgaagcatttgtgcgccacattatggctggttga

DBGET integrated database retrieval system