Danio rerio (zebrafish): 799355 Help Entry 799355            CDS       T01004                                  Symbol pfn1 Name (RefSeq) profilin-1   KO K05759   profilin Organism dre  Danio rerio (zebrafish) Pathway dre04810   Regulation of actin cytoskeleton dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     799355 (pfn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     799355 (pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dre04131]     799355 (pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dre04812]     799355 (pfn1)    04147 Exosome [BR:dre04147]     799355 (pfn1) Membrane trafficking [BR:dre04131]  Others   Actin-binding proteins    Others     799355 (pfn1) Cytoskeleton proteins [BR:dre04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      799355 (pfn1) Exosome [BR:dre04147]  Exosomal proteins   Proteins found in most exosomes    799355 (pfn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  799355 NCBI-ProteinID:  NP_001292517 ZFIN:  ZDB-GENE-031002-33 Ensembl:  ENSDARG00000088091 UniProt:  E7F0A1 LinkDB All DBs Position 23:44599064..44604195 Genome browser AA seq 141 aa AA seqDB search MSWDSYISSLTQSEWVDDAVILGATPGQESIWASAPGGWLSGVTAAEVKAILNTDRGKLF CNGVTLAGKRCTVVRDALFVDGQFTMDVKMKTSEKEPDPFSLTIGKSISALIIAKGVKDA HGGKVNPPVFDMALYLRKMNM NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgagctgggacagctacatcagcagcctgacccagagcgagtgggtggatgatgcggtc atcctcggtgcaacaccgggtcaggagtccatttgggcgtcagcaccgggaggctggctc tcgggcgtaacggcagcagaggttaaggcaatcctcaacacagaccgcgggaaactgttt tgcaatggtgtgactttggccggcaagcgctgcactgtggtgagagacgctctgtttgtg gacggtcaattcacgatggacgtcaagatgaagacctccgagaaagagcccgaccctttc tcattgaccatcggcaaatctataagcgcattaatcattgctaaaggagtaaaagatgct cacggaggcaaagtcaacccacccgttttcgacatggctctttacctcaggaagatgaac atgtga

DBGET integrated database retrieval system