Desmodus rotundus (common vampire bat): 112300024 Help Entry 112300024         CDS       T05907                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04060   Cytokine-cytokine receptor interaction dro04151   PI3K-Akt signaling pathway dro04217   Necroptosis dro04380   Osteoclast differentiation dro04620   Toll-like receptor signaling pathway dro04621   NOD-like receptor signaling pathway dro04622   RIG-I-like receptor signaling pathway dro04623   Cytosolic DNA-sensing pathway dro04630   JAK-STAT signaling pathway dro04650   Natural killer cell mediated cytotoxicity dro04668   TNF signaling pathway dro04936   Alcoholic liver disease dro05135   Yersinia infection dro05142   Chagas disease dro05152   Tuberculosis dro05160   Hepatitis C dro05161   Hepatitis B dro05162   Measles dro05163   Human cytomegalovirus infection dro05164   Influenza A dro05165   Human papillomavirus infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05168   Herpes simplex virus 1 infection dro05169   Epstein-Barr virus infection dro05170   Human immunodeficiency virus 1 infection dro05171   Coronavirus disease - COVID-19 dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112300024 (IFNB1)    04668 TNF signaling pathway     112300024 (IFNB1)    04151 PI3K-Akt signaling pathway     112300024 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112300024 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112300024 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112300024 (IFNB1)    04621 NOD-like receptor signaling pathway     112300024 (IFNB1)    04622 RIG-I-like receptor signaling pathway     112300024 (IFNB1)    04623 Cytosolic DNA-sensing pathway     112300024 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     112300024 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     112300024 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112300024 (IFNB1)    05161 Hepatitis B     112300024 (IFNB1)    05160 Hepatitis C     112300024 (IFNB1)    05171 Coronavirus disease - COVID-19     112300024 (IFNB1)    05164 Influenza A     112300024 (IFNB1)    05162 Measles     112300024 (IFNB1)    05168 Herpes simplex virus 1 infection     112300024 (IFNB1)    05163 Human cytomegalovirus infection     112300024 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     112300024 (IFNB1)    05169 Epstein-Barr virus infection     112300024 (IFNB1)    05165 Human papillomavirus infection     112300024 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     112300024 (IFNB1)    05152 Tuberculosis     112300024 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     112300024 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112300024 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112300024 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112300024 (IFNB1) Cytokines and neuropeptides [BR:dro04052]  Cytokines   Interferons    112300024 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112300024 NCBI-ProteinID:  XP_024411006 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MANRSIVQVALLLCFSSTALSVSYDVLQFQQRGSISACRTLLRQLNGTFYYCLKDRMDFK FPEEIKLQKFQEEEAILVIHEMLQQIFDLFRRNLSSTGWNQTIIEKLYEELSWQMDHLEA ALEDIMEEGNFTWEESRTLLHLKQYYLRIVQYLKAKLYSRCAWTVVRGHILKNFSVLYTL TDLIFKN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccaacaggagcatcgtccaggtagctctcctgctgtgtttctccagcacagctctt tccgtgagctacgatgtgcttcagttccaacagagaggcagtatttcagcctgtcggact ctcctccggcagttgaatggaaccttttactattgcctcaaggacaggatggacttcaag ttcccggaggagattaaactacagaagttccaggaggaggaagccatattggtcatccat gagatgctccagcagatcttcgatcttttcagaagaaatttgtccagcaccggctggaat cagaccatcattgagaaactctatgaggaactcagttggcagatggaccatctggaggca gccctggaggacatcatggaggagggaaacttcacctgggaagaaagcaggaccctgctg cacctaaagcagtattacttaaggattgtacagtatctgaaggccaagttgtacagcaga tgtgcctggacagtggtccgagggcacatcctcaagaacttttccgtgctttacacactt acagatcttatcttcaaaaactga

DBGET integrated database retrieval system