Desmodus rotundus (common vampire bat): 112317162 Help Entry 112317162         CDS       T05907                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro00510   N-Glycan biosynthesis dro00513   Various types of N-glycan biosynthesis dro04141   Protein processing in endoplasmic reticulum Module dro_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dro00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     112317162 (TMEM258)    00513 Various types of N-glycan biosynthesis     112317162 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112317162 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  112317162 NCBI-ProteinID:  XP_024429967 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtactgttggccattggcatgttcttcaccgcctggttcttcgtttacgag gtcacctccaccaagtacactcgggacatctacaaagagctcctcatctccttggtggcc tcgctcttcatgggctttggggtcctcttccttctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system