Desmodus rotundus (common vampire bat): 112318977 Help Entry 112318977         CDS       T05907                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04010   MAPK signaling pathway dro04014   Ras signaling pathway dro04015   Rap1 signaling pathway dro04024   cAMP signaling pathway dro04062   Chemokine signaling pathway dro04510   Focal adhesion dro04517   IgSF CAM signaling dro04520   Adherens junction dro04611   Platelet activation dro04670   Leukocyte transendothelial migration dro04720   Long-term potentiation dro04722   Neurotrophin signaling pathway dro04934   Cushing syndrome dro04972   Pancreatic secretion dro05211   Renal cell carcinoma dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112318977 (RAP1B)    04014 Ras signaling pathway     112318977 (RAP1B)    04015 Rap1 signaling pathway     112318977 (RAP1B)    04024 cAMP signaling pathway     112318977 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112318977 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     112318977 (RAP1B)    04520 Adherens junction     112318977 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     112318977 (RAP1B)    04670 Leukocyte transendothelial migration     112318977 (RAP1B)    04062 Chemokine signaling pathway     112318977 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     112318977 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     112318977 (RAP1B)    04722 Neurotrophin signaling pathway     112318977 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     112318977 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112318977 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     112318977 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112318977 (RAP1B)    04031 GTP-binding proteins [BR:dro04031]     112318977 (RAP1B) Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112318977 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    112318977 (RAP1B)   Exosomal proteins of colorectal cancer cells    112318977 (RAP1B) GTP-binding proteins [BR:dro04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     112318977 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  112318977 NCBI-ProteinID:  XP_024431977 UniProt:  K9IWM3 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggttcaggaggtgttggaaaatctgcactgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcggga acggaacaatttacagcaatgagagatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaatcaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcctca tgtcagctgctttaa

DBGET integrated database retrieval system