Drosophila sechellia: 6610179 Help Entry 6610179           CDS       T01064                                  Name (RefSeq) RING-box protein 1B   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dse  Drosophila sechellia Pathway dse03420   Nucleotide excision repair dse04120   Ubiquitin mediated proteolysis dse04141   Protein processing in endoplasmic reticulum dse04310   Wnt signaling pathway dse04341   Hedgehog signaling pathway - fly dse04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dse00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6610179    04120 Ubiquitin mediated proteolysis     6610179   09124 Replication and repair    03420 Nucleotide excision repair     6610179  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6610179    04341 Hedgehog signaling pathway - fly     6610179    04350 TGF-beta signaling pathway     6610179  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dse04121]     6610179    03400 DNA repair and recombination proteins [BR:dse03400]     6610179 Enzymes [BR:dse01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6610179 Ubiquitin system [BR:dse04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6610179   Multi subunit type E3    SCF complex     Ring finger protein      6610179    Cul2 complex      6610179    Cul3 complex      6610179    Cul4 complex      6610179    Cul7 complex      6610179    Cul8 complex      6610179    Cul9 complex      6610179 DNA repair and recombination proteins [BR:dse03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6610179     TCR (transcription coupled repair) factors      Cul4-CSA complex       6610179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  6610179 NCBI-ProteinID:  XP_002034787 UniProt:  B4HVF8 LinkDB All DBs Position 3L:437413..437984 Genome browser AA seq 122 aa AA seqDB search MAEEMEVEETEDFHDMDFNDEEPSCSGGAGQARTERFVVKKWVAHAMWGWDVAVDNCAIC RNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKEWVYQKY GR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccgaagagatggaggttgaggagacggaggacttccacgacatggacttcaatgac gaagagccatcctgtagtggaggagctggccaagccaggacggagcgctttgtggtgaag aagtgggttgcgcacgccatgtggggatgggacgtagcagtggacaactgtgccatctgc cgtaaccacatcatgaacctgtgcatcgagtgccaggcggacccgaatgcaaaccaagac gagtgcactgtggcttggggcgagtgcaaccacgctttccattaccactgcatcgcgcgc tggttgaaaacgcgcctggtctgtccgctggacaacaaggagtgggtctaccagaagtac ggccgctag

DBGET integrated database retrieval system