Drosophila sechellia: 6615886 Help Entry 6615886           CDS       T01064                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dse  Drosophila sechellia Pathway dse03420   Nucleotide excision repair dse04120   Ubiquitin mediated proteolysis dse04141   Protein processing in endoplasmic reticulum dse04310   Wnt signaling pathway dse04341   Hedgehog signaling pathway - fly dse04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dse00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6615886    04120 Ubiquitin mediated proteolysis     6615886   09124 Replication and repair    03420 Nucleotide excision repair     6615886  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6615886    04341 Hedgehog signaling pathway - fly     6615886    04350 TGF-beta signaling pathway     6615886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dse04121]     6615886    03400 DNA repair and recombination proteins [BR:dse03400]     6615886 Enzymes [BR:dse01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6615886 Ubiquitin system [BR:dse04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6615886   Multi subunit type E3    SCF complex     Ring finger protein      6615886    Cul2 complex      6615886    Cul3 complex      6615886    Cul4 complex      6615886    Cul7 complex      6615886    Cul8 complex      6615886    Cul9 complex      6615886 DNA repair and recombination proteins [BR:dse03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6615886     TCR (transcription coupled repair) factors      Cul4-CSA complex       6615886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  6615886 NCBI-ProteinID:  XP_002040256 UniProt:  B4I946 LinkDB All DBs Position X:613650..614557 Genome browser AA seq 108 aa AA seqDB search MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaagtcgacgaggatggatacgaggttccctccagcagcagcaagggcgataagaag cgctttgaggtgaagaagtggaacgccgtggcattgtgggcctgggacatcgtagtggac aactgcgccatctgccgcaaccacatcatggacttgtgcatcgagtgccaggcgaaccag gcgtccgctactagcgaggagtgcaccgtggcctggggcgtctgcaaccacgccttccat ttccactgcatctctcgctggctaaagacgcgccaggtgtgcccactggacaaccgcgag tgggatttccagaagtacggccactaa

DBGET integrated database retrieval system