Dinoroseobacter shibae: Dshi_2181 Help Entry Dshi_2181         CDS       T00612                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsh  Dinoroseobacter shibae Pathway dsh01100   Metabolic pathways dsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dshi_2181 (acpP)    00074 Mycolic acid biosynthesis     Dshi_2181 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dshi_2181 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ABV93917 RoseoBase:  Dshi_2181 UniProt:  A8LQQ0 LinkDB All DBs Position complement(2309189..2309422) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEESKVVENASFIDDLGADSLDTVELVMAFEEEFSIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtagcggatcgcgtgaagaagatcgtggtggagcatctgggcgtggaagag agcaaggtcgttgaaaacgcgtccttcatcgacgacctcggcgcggacagcctggatacg gtcgagctggtcatggccttcgaagaagagttcagcatcgagatcccggacgatgccgcc gagaccattcagacctttggcgatgcggtgaagttcatctccgaagcgtcctga

DBGET integrated database retrieval system