Dinoroseobacter shibae: Dshi_3363 Help Entry Dshi_3363         CDS       T00612                                  Name (GenBank) putative flagellar protein FlgJ   KO K02395   peptidoglycan hydrolase FlgJ Organism dsh  Dinoroseobacter shibae Pathway dsh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:dsh00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Dshi_3363  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:dsh02035]     Dshi_3363 Bacterial motility proteins [BR:dsh02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     Dshi_3363 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  ABV95096 RoseoBase:  Dshi_3363 UniProt:  A8LNK2 LinkDB All DBs Position complement(3535242..3535544) Genome browser AA seq 100 aa AA seqDB search MERIAHFSPALSTARAQDAQSGSSALEQAAKDLEAAFLSVMLKEARFGVTPETMGGGVGE DQFASFLRDEHAKALVENGGIGLAEALFNALKGDVDVEST NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggaacgaatcgcacatttttctcccgccctctcgactgcccgtgcccaagacgcccag agtggcagttctgccttggaacaggccgcaaaggatctggaggcggccttcctctcggtc atgctcaaggaagcgcgcttcggggtgacgccggaaaccatgggaggcggtgtcggagaa gatcagttcgcttcgttcttgagggatgaacacgccaaggccctcgtggaaaatggaggc atcggtttggccgaagcgcttttcaacgccttgaagggagatgtcgatgtggagagcacg tga

DBGET integrated database retrieval system