Diprion similis: 124404377 Help Entry 124404377         CDS       T08947                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism dsm  Diprion similis Pathway dsm00510   N-Glycan biosynthesis dsm00513   Various types of N-glycan biosynthesis dsm04141   Protein processing in endoplasmic reticulum Module dsm_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dsm00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     124404377    00513 Various types of N-glycan biosynthesis     124404377  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124404377 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Pox_E2-like Motif Other DBs NCBI-GeneID:  124404377 NCBI-ProteinID:  XP_046734419 LinkDB All DBs Position 3:complement(3758509..3759441) Genome browser AA seq 80 aa AA seqDB search MIEIESMTRYVSPINPAVFPHLAVVLLGIGIFFTAWFFVYEVTSTKFTRDIFKELLVSLV AAIFSGFGVLFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgattgaaatcgagtccatgacgaggtacgtctcgccgataaacccagccgtgtttcca catttggctgtagtcctgttaggaatcggtatattctttaccgcatggtttttcgtgtat gaagtaaccagcaccaagtttaccagagacatattcaaggaattgctggtctccttagtt gctgcaatattctccggattcggtgtactgttcctactgctttgggtcggaatttatgtt tag

DBGET integrated database retrieval system