Dichomitus squalens: DICSQDRAFT_136248 Help Entry DICSQDRAFT_136248 CDS       T03133                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dsq  Dichomitus squalens Pathway dsq03420   Nucleotide excision repair dsq04111   Cell cycle - yeast dsq04120   Ubiquitin mediated proteolysis dsq04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dsq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     DICSQDRAFT_136248    04120 Ubiquitin mediated proteolysis     DICSQDRAFT_136248   09124 Replication and repair    03420 Nucleotide excision repair     DICSQDRAFT_136248  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     DICSQDRAFT_136248  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dsq04121]     DICSQDRAFT_136248    03400 DNA repair and recombination proteins [BR:dsq03400]     DICSQDRAFT_136248 Enzymes [BR:dsq01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      DICSQDRAFT_136248 Ubiquitin system [BR:dsq04121]  Ubiquitin ligases (E3)   UBL E3 ligases    DICSQDRAFT_136248   Multi subunit type E3    SCF complex     Ring finger protein      DICSQDRAFT_136248    Cul2 complex      DICSQDRAFT_136248    Cul3 complex      DICSQDRAFT_136248    Cul4 complex      DICSQDRAFT_136248    Cul7 complex      DICSQDRAFT_136248    Cul8 complex      DICSQDRAFT_136248    Cul9 complex      DICSQDRAFT_136248 DNA repair and recombination proteins [BR:dsq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       DICSQDRAFT_136248     TCR (transcription coupled repair) factors      Cul4-CSA complex       DICSQDRAFT_136248 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 Motif Other DBs NCBI-GeneID:  18835441 NCBI-ProteinID:  XP_007365421 JGI:  136248 UniProt:  R7T188 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MADTMDVDVDPPTTAEPKGKTKEDAKGDKKRFEVKKWNAVALWAWDIVVENCAICRNHIM DLCIDCQANQVSATSEECNAAWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccgacacgatggatgtcgatgtggatcctccgactaccgctgagcccaagggtaag accaaggaggacgccaagggcgacaagaagcgctttgaagtcaagaagtggaacgccgtg gccctttgggcatgggacattgtcgtcgagaactgcgcaatctgcaggaatcacatcatg gatctctgcatcgattgccaggcgaaccaggtctccgccacttccgaggaatgtaacgcc gcctggggtatctgcaaccatgcattccacttccattgcatctcgcggtggctcaagacg cgtaacgtatgccccctggacaaccgagagtgggagttgcagaagtatggtcgctaa

DBGET integrated database retrieval system