Drosophila serrata: 110181527 Help Entry 110181527         CDS       T06108                                  Name (RefSeq) RING-box protein 1B   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dsr  Drosophila serrata Pathway dsr03420   Nucleotide excision repair dsr04120   Ubiquitin mediated proteolysis dsr04141   Protein processing in endoplasmic reticulum dsr04310   Wnt signaling pathway dsr04341   Hedgehog signaling pathway - fly dsr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dsr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110181527    04120 Ubiquitin mediated proteolysis     110181527   09124 Replication and repair    03420 Nucleotide excision repair     110181527  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     110181527    04341 Hedgehog signaling pathway - fly     110181527    04350 TGF-beta signaling pathway     110181527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dsr04121]     110181527    03400 DNA repair and recombination proteins [BR:dsr03400]     110181527 Enzymes [BR:dsr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110181527 Ubiquitin system [BR:dsr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110181527   Multi subunit type E3    SCF complex     Ring finger protein      110181527    Cul2 complex      110181527    Cul3 complex      110181527    Cul4 complex      110181527    Cul7 complex      110181527    Cul8 complex      110181527    Cul9 complex      110181527 DNA repair and recombination proteins [BR:dsr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110181527     TCR (transcription coupled repair) factors      Cul4-CSA complex       110181527 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_UBOX Motif Other DBs NCBI-GeneID:  110181527 NCBI-ProteinID:  XP_020804963 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MSEEIEIEEAEDFHSLGSNEDEAASGSGTAGTGTGAGGSNINGTVQTREDRFALKKWVAH ALWSWDVAVDNCAICRNHIMTLCIECQADPNAHKDECTVAWGECNHAFHYHCISRWLKTR QVCPLDNKEWVYQKYGH NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagagatagagattgaggaggccgaggacttccatagcttgggctctaacgag gatgaggctgcctctggcagtggcactgccggcactggcaccggcgccggtggcagcaac attaacggtactgtccagactcgggaggatcgctttgcgttgaagaagtgggtggcacac gcactgtggtcatgggacgtggccgtggataactgtgccatctgtcggaatcacatcatg accttgtgcatcgagtgccaggcggatccgaatgcccacaaggatgagtgcacggtggcc tggggggagtgtaatcatgcttttcactaccactgtatatcgcgttggctcaagacccgc caggtgtgtccgctggacaacaaggagtgggtctatcaaaagtatggacactaa

DBGET integrated database retrieval system