Dermacentor silvarum: 119456610 Help Entry 119456610         CDS       T07348                                  Name (RefSeq) protein max   KO K04453   Max protein Organism dsv  Dermacentor silvarum Pathway dsv03083   Polycomb repressive complex Brite KEGG Orthology (KO) [BR:dsv00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     119456610  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:dsv03000]     119456610    03036 Chromosome and associated proteins [BR:dsv03036]     119456610 Transcription factors [BR:dsv03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     119456610 Chromosome and associated proteins [BR:dsv03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      119456610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH SLX9 DUF3958 ATG16 KASH_CCD bHLH_INO4 RelA_SpoT bHLH_INO2 APG6_N Motif Other DBs NCBI-GeneID:  119456610 NCBI-ProteinID:  XP_037574365 LinkDB All DBs Position 6:38227340..38227858 Genome browser AA seq 106 aa AA seqDB search MNDEERDMGVEAERRAHHSALERRRRDQIKFTFDCLRDAVPSLQWERATRAQILKRATDY IQLMQRRNRERLHTIKDLKREKKHLEDQIRAFGGEGDAQRRWRLPA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgaacgacgaggaacgtgatatgggcgtcgaggccgagaggagggcccaccacagcgct ctcgagcgaaggcgacgagaccagatcaagttcacgttcgactgtctgcgggacgccgtg ccgtctctgcaatgggagagggctacgcgcgcccagatcctgaagcgggccaccgactac atacagctgatgcagcgcaggaacagggagcggctgcacaccatcaaggacctcaagcga gagaagaagcatctagaggatcagatacgggcatttggaggggagggagatgcgcagcgg cggtggcgactgcccgcctag

DBGET integrated database retrieval system