Deinococcus radiopugnans: QR90_04560
Help
Entry
QR90_04560 CDS
T03508
Name
(GenBank) NAD-dependent DNA ligase LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
dsw
Deinococcus radiopugnans
Pathway
dsw03030
DNA replication
dsw03410
Base excision repair
dsw03420
Nucleotide excision repair
dsw03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
dsw00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
QR90_04560
03410 Base excision repair
QR90_04560
03420 Nucleotide excision repair
QR90_04560
03430 Mismatch repair
QR90_04560
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
dsw03032
]
QR90_04560
03400 DNA repair and recombination proteins [BR:
dsw03400
]
QR90_04560
Enzymes [BR:
dsw01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
QR90_04560
DNA replication proteins [BR:
dsw03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
QR90_04560
DNA repair and recombination proteins [BR:
dsw03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
QR90_04560
NER (nucleotide excision repair)
GGR (global genome repair) factors
QR90_04560
MMR (mismatch excision repair)
DNA ligase
QR90_04560
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
QR90_04560
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
HHH_5
DNA_ligase_ZBD
Nlig-Ia
PTCB-BRCT
HHH
BRCT_2
Zn_Ribbon_TF
Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID:
AIZ44523
UniProt:
A0A0A7KJ08
LinkDB
All DBs
Position
942862..944937
Genome browser
AA seq
691 aa
AA seq
DB search
MDQAELTPGEYEQYLSLSAAVARHNRAYHEEDAPTIPDSEYDALVRRLRALEAQHPEWAE
QAAQAVGADTSPAQAVGGAPSTAFQPVDHPTPMTSLDNVFSDAELGEWREKLARALNLPP
EHDDFVFTGELKIDGLSVNLYYVNGQLQWAATRGNGSVGEIVTAQVATVPGIPTVLDGLS
GELEVRGEVYMSRADFAAYNAQAEELGTPLLKNPRNGAAGALRQKDPEVTRTRNLKAIFY
ALGKRDGVPATTQGEVLAWLAAQGFPISTHSEGLSGIAAAADYHARMTAGRQDFEFDADG
TVFKVDSLRLQEEAGFTSRAPRWAIAYKFPVEEVETVLEGITVNVGRTGKLTPLAHLSPR
LIEGSTVSKATLHNQDFVRDLDLHIGDTVVVRKSGGVIPQIMRVIVDKRPADAQPFVFPD
TCPECGQPVTRDPEDANTYCTNPACPAQTYKLVEYFVSRGAMDIAGVGGKLIAQLLTLGL
IHDAADLYALNAETLAGLERGGEKKAANILAELEASKTRPLWRLINALGLDHVGERNAQA
LARAFGTLDALMAATPEQIEAVPGLGKVIGASVAVALKEEGYVTLLNKLKAAGVNPQEEE
VRRGEQLEGLNFVITGSLGRPRDAIKAELEAAGGRVTGSVTGKTSYLIAGEDAGSKLTRA
QELGVAVLDEAGLAALLAEKGVENGEASAQT
NT seq
2076 nt
NT seq
+upstream
nt +downstream
nt
atggatcaggccgagttgacccccggtgaatacgagcagtacctcagtctcagcgccgcc
gtggcccgccacaaccgcgcgtaccacgaggaggacgcgcccacgattcccgacagcgag
tacgacgcgctggttcggcgcctgcgtgccctggaagcccagcatcccgaatgggccgag
caggccgcgcaggcggtaggggccgacaccagtcccgcgcaggcggtggggggggcgccc
agcacggccttccagccggtagaccaccccacccccatgaccagcctggacaacgtcttc
agcgacgccgaactgggcgagtggcgcgagaagctggcccgcgcgctgaacctgcccccc
gagcacgacgacttcgtgttcacgggcgagctgaagatcgacggcctgagcgtgaacctg
tactacgtgaacggtcagttgcagtgggccgccacgcgcggcaacggctccgtcggcgag
atcgtgaccgcgcaggtggcgacggtgccgggcattcccaccgtcctggacggcctgagc
ggtgaactggaggtgcgcggcgaggtctacatgagccgcgcggacttcgccgcctacaac
gcgcaggccgaggaactgggcacgccgctgctcaagaacccccgcaacggcgcggcggga
gcgctgcggcagaaagacccggaggtcacgcgcacccgcaacctcaaggccatcttctac
gcgctgggcaagcgcgacggcgtgcccgccactacccagggcgaggtgctggcgtggctg
gccgcccagggctttccgatcagcacccacagcgaggggctgagcggcatcgccgccgcc
gccgactaccacgcccgaatgactgccggacgtcaggacttcgaattcgatgccgatggc
acagtgttcaaggtcgattcgctgcgcctgcaggaggaggcgggctttaccagccgcgcc
ccgcgctgggccattgcctacaagttcccggtggaggaagtggagactgtgctggagggc
attacggtcaacgtgggccgcaccggcaagctgaccccgctggcccacctgtcgccgcgc
ctgatcgagggcagcaccgtcagcaaggccacgctgcacaaccaggatttcgtgcgggat
ctggatcttcacattggggacacggtggtggtgcgcaaatccggcggcgtgattccgcag
atcatgcgtgtgatcgtggacaaacgcccggcagacgcccagcccttcgtctttcccgac
acctgccccgagtgcggccagccggtcacgcgcgatcccgaggacgccaacacctactgc
accaatccggcctgcccggcgcagacctacaaactggtggagtatttcgtgtcgcgcggc
gccatggacatcgcgggcgtggggggcaagctgatcgcgcaactgctgacgctgggcctg
atccacgacgcggcagacctatacgccctgaacgccgagacgctggccgggctggagcgc
ggcggcgagaagaaggccgccaacatcctggccgagctggaggccagcaagacccgcccg
ctgtggcgcctgatcaacgcgctgggcctggatcacgtgggcgagcgcaacgcccaggcg
ctggcccgcgccttcggcacgctggacgcgctgatggcggccactcccgagcagatcgag
gccgtgccggggctgggcaaggtgatcggcgcaagtgtggcggtggccctgaaagaagag
ggctacgtcaccctcctgaacaaactcaaggcggcgggcgtcaacccgcaggaggaggag
gtgaggcgcggagagcaactggagggcctcaacttcgtcatcaccggcagcctgggccgt
ccgcgcgacgccatcaaagccgagctggaggccgccgggggccgcgtgactggcagcgtc
accggcaagacctcgtacctgatcgctggggaggacgctggaagcaaattgacccgcgcg
caggagctgggcgtggccgtgctggacgaggccggactggcggctctgctggcggagaag
ggcgtagaaaacggggaggcgtccgcccagacctga
DBGET
integrated database retrieval system