KEGG   Desulfitobacterium hafniense Y51: DSY3157
Entry
DSY3157           CDS       T00333                                 
Name
(GenBank) hypothetical protein
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00670  One carbon pool by folate
dsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DSY3157
Enzymes [BR:dsy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     DSY3157
SSDB
Motif
Pfam: MtrH CobD_Cbib DUF3306
Other DBs
NCBI-ProteinID: BAE84946
UniProt: Q24SP6
Structure
LinkDB
Position
complement(3573315..3574235)
AA seq 306 aa
MFKFTAQQHVYDINGVKVGGQPGEYPTVLIGSIFYRGHKIVSDGQKGIFDKDAAKALLDQ
EAELSAETGNPFIIDVLGESVEALTKYVEFILENTTAPFLLDSISPDVRVGALKNLGKDP
EIQKRLIYNSIEEHYTEEELAAIKEAGLKTAVILAFSKKALKPNARIDLLQGKDDKEGLI
AAAKRAGIEQFLVDPGVLDVASNSWTTEAINVVKEQFGYPGGCAPSNAVYLWKKMRSKGT
PFFEVAGAAVFTYPITQGADFILYGPMMNAPWVYRAIATTDAMIAYNNKLTGVKMGTTEH
PLLKIF
NT seq 921 nt   +upstreamnt  +downstreamnt
atgttcaaatttactgctcaacaacatgtttatgacatcaatggggttaaggttggtggt
cagcctggggaatacccaacagtgctcatcggcagcattttttatcggggccataagatc
gtctcagatggtcaaaagggaattttcgacaaagatgcagccaaagctttgctggatcag
gaagccgaactaagcgcagaaacaggcaatccatttatcattgatgtcttgggagaatct
gttgaagcccttacgaaatacgtggaatttattttggaaaataccactgccccattcctc
ctggatagtatcagcccggatgtgcgggtaggagccctgaaaaatttgggcaaggatccg
gagattcagaaacggctgatctacaattccattgaagagcattacaccgaagaagagctg
gccgccatcaaagaggcagggctgaagaccgccgttatccttgctttcagtaagaaagcg
ttaaagcccaatgcccgcatcgatcttctccagggcaaggatgataaagaagggttgatt
gcagcggccaaacgggccggtatcgagcaattccttgtggatccgggagtcttggatgtg
gccagcaatagctggacgacggaagcgatcaatgtggttaaagagcaattcggctatccc
ggtggctgtgcgccatccaatgcagtctatctctggaagaaaatgcgttccaaaggaacc
cccttcttcgaagttgccggggctgcggtcttcacttatccgatcacacagggtgccgat
ttcattctctatggtcccatgatgaacgctccctgggtttatcgtgctatagcaaccaca
gatgccatgattgcctataacaataagctgaccggagttaagatgggaaccacagagcat
cctttgctcaaaattttctaa

DBGET integrated database retrieval system