Duganella dendranthematis: HH213_27510
Help
Entry
HH213_27510 CDS
T06560
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
dug
Duganella dendranthematis
Pathway
dug03030
DNA replication
dug03410
Base excision repair
dug03420
Nucleotide excision repair
dug03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
dug00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
HH213_27510 (ligA)
03410 Base excision repair
HH213_27510 (ligA)
03420 Nucleotide excision repair
HH213_27510 (ligA)
03430 Mismatch repair
HH213_27510 (ligA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
dug03032
]
HH213_27510 (ligA)
03400 DNA repair and recombination proteins [BR:
dug03400
]
HH213_27510 (ligA)
Enzymes [BR:
dug01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
HH213_27510 (ligA)
DNA replication proteins [BR:
dug03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
HH213_27510 (ligA)
DNA repair and recombination proteins [BR:
dug03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
HH213_27510 (ligA)
NER (nucleotide excision repair)
GGR (global genome repair) factors
HH213_27510 (ligA)
MMR (mismatch excision repair)
DNA ligase
HH213_27510 (ligA)
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
HH213_27510 (ligA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
DNA_ligase_ZBD
PTCB-BRCT
Nlig-Ia
BRCT_2
DZR_2
DUF4796_N
Motif
Other DBs
NCBI-ProteinID:
QJD93501
UniProt:
A0ABX6MGN5
LinkDB
All DBs
Position
complement(6011794..6014133)
Genome browser
AA seq
779 aa
AA seq
DB search
MTEVDFKTRIEQLSAELNRHLHAYHVEDAPTIPDAEYDKLFITLQKLEEEYPELALPDSP
TKRVGAAPLPQFDQVTHTVPMLSLNNGFSDEDIENFDRRVREGLDTAALVEYAAEVKYDG
LAINLRYIDGVLAQAATRGDGYTGEDVTANIRTIRSIPLRLKTDNPPAILDVRGEVLMFK
RDFQALNARQREAGQKEFANPRNAAAGSLRQLDSRITASRKLSFFAYGVGALEGAEMPLS
HSALLDWYRQLGLPVAKEASLVRGYDGLMAYYKQIGDARPGMPYEIDGVVYKANLLADQR
ALGFVSRAPRFALAHKFPAEEALTVVQAIEVQVGRTGAITPVARLASVFVGGVNVTNATL
HNEDEVRRKDVRVGDTVIVRRAGDVIPEVLAVVLERRPTPEPAQYVLPKTCPVCGSHVVR
EEGEAIARCSGGLFCSAQRKEAIRHFAGRRMMDIEGLGDRYIDSLVEWGKVQRVADLYSL
KLEDLLEMKRLADERDGTTPETVAKGKIATKWADNLLEAIAASKNPPLERLLFALGIRHV
GESTAKTLAEWLGRFDLIRRVPAALLRVLPDIGGTVAESIADFFAEEKNQEAIDALLAAG
VAPKDEHPPSAKLREKLDTVKLMAALAIPKLTEPRSKQLVEEGVTLEALAYLQVFNVFGL
PATVSDALEAWMSEPANRAQVKALHLLRNDLLAQLPETVAAEGHLTGKTFVLTGTLPNMG
RDQAAALIEAEGGKISGSVSKKTHYLVAGADAGSKLAKAQELEVTILDEAGLLELLAQK
NT seq
2340 nt
NT seq
+upstream
nt +downstream
nt
atgacggaagtagatttcaaaacgcgcatcgagcaactcagcgcggagctgaaccggcat
ttgcacgcctatcatgtggaagacgcgccgactattccggacgcggagtatgacaagctg
tttatcacgctgcaaaagctggaggaagaataccccgagctggcgctgccggactcgccg
accaagcgcgtaggcgcggccccgctgccgcagttcgaccaagtcacgcacacggtgccg
atgctgtcgctgaataacggcttcagcgacgaggatatcgagaacttcgaccgccgcgtg
cgcgaaggcctggatacggccgcactggtggaatacgcagccgaagtaaagtacgatggc
ctggccatcaacctgcgctatatcgatggcgttctggcgcaggcggccacgcgcggcgac
ggctacaccggcgaggatgtcaccgccaatatccgcaccatccgtagcatccctttgcgc
ctgaagaccgacaacccgcccgccatccttgatgtgcgcggcgaagtgctgatgttcaag
cgcgatttccaagcgttgaatgcccgccagcgcgaagcgggacagaaggaattcgccaac
ccgcgcaacgccgcggcgggcagcctgcgacagctggattcacgcatcaccgcctcgcgc
aaactgagtttctttgcctatggcgtcggcgcgctggaaggcgccgagatgccgctgtcg
cattccgcgctgctggactggtatcgccagcttggcctgccggtggccaaggaagcctcg
ctggtgcgcggctacgatggcctgatggcgtactacaagcagatcggcgacgcccgtcca
ggcatgccgtacgagatcgacggcgtggtctacaaggccaacctgctggccgaccagcgc
gcgctgggcttcgtttcgcgtgcgccgcgtttcgcgctggcgcacaaattcccggccgaa
gaagcgctgaccgtcgtgcaggcgattgaagtgcaggtcggccgcaccggcgcgattacg
ccggtggcgcggctggcgtccgtgttcgtcggtggcgtcaacgttacgaacgctacgctg
cacaatgaagatgaggtgcgccgcaaggacgtgcgcgttggcgacaccgtcatcgtgcgg
cgcgccggcgacgtgattcctgaggtgctggcggtggtgctggagcgtcgtccaacgccg
gagccggcgcaatacgtgctgccgaaaacctgcccggtgtgcggctcgcacgttgtgcgc
gaagagggcgaggcgattgcgcgctgctccggtggcctgttctgttccgcgcagcgcaag
gaagccatacgccacttcgccggccgtcgcatgatggacatcgaaggcctgggcgaccgc
tacatcgacagtctggtcgaatggggcaaggtgcagcgcgtggccgacctgtattcgctg
aagctggaagacctgctggaaatgaagcgcctcgccgatgaacgcgatggcacgacgccg
gagacggtcgccaagggcaagatcgccaccaagtgggcggacaatctgctggaggccatc
gccgccagcaagaatccgccgctggagcgcctgctgttcgcgctgggcatccgccacgtc
ggcgagtccaccgccaagacgctggccgagtggctgggccgctttgacctcatccgccgc
gtgccggccgcgctgctgcgcgtgctgcccgatattggcggcaccgtggctgaatcgatc
gccgacttcttcgccgaagagaagaaccaggaagccatcgatgcactgctggccgccggt
gtggcgccgaaagacgagcatccgccaagcgccaagctgcgcgaaaagctggacacggtc
aagctgatggcggcgctggcgattcccaaattgacggaaccgcgcagcaagcagctggtg
gaagaaggcgtgacgctggaagcgctggcttacctgcaggtgttcaacgtcttcggcctg
ccggccactgtatcggatgcgcttgaggcgtggatgtcggagccggctaaccgcgcgcaa
gtcaaggcgctgcatctgctgcgcaacgacctgctggcgcagctgccggaaacagtggcc
gccgaaggtcacctgaccggcaaaacctttgtattaaccggcaccttgccgaatatgggc
cgcgaccaggctgctgcgctgattgaagcggagggcggcaagatctccggttcggtctcg
aaaaaaacacactatctggttgccggcgcagacgccggcagcaaactggccaaagcacaa
gagctggaagtcaccattttggatgaagccggcctgctcgaactcctcgcacaaaaataa
DBGET
integrated database retrieval system