Drosophila virilis: 6626811 Help Entry 6626811           CDS       T01066                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dvi  Drosophila virilis Pathway dvi03420   Nucleotide excision repair dvi04120   Ubiquitin mediated proteolysis dvi04141   Protein processing in endoplasmic reticulum dvi04310   Wnt signaling pathway dvi04341   Hedgehog signaling pathway - fly dvi04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dvi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6626811    04120 Ubiquitin mediated proteolysis     6626811   09124 Replication and repair    03420 Nucleotide excision repair     6626811  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6626811    04341 Hedgehog signaling pathway - fly     6626811    04350 TGF-beta signaling pathway     6626811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dvi04121]     6626811    03400 DNA repair and recombination proteins [BR:dvi03400]     6626811 Enzymes [BR:dvi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6626811 Ubiquitin system [BR:dvi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6626811   Multi subunit type E3    SCF complex     Ring finger protein      6626811    Cul2 complex      6626811    Cul3 complex      6626811    Cul4 complex      6626811    Cul7 complex      6626811    Cul8 complex      6626811    Cul9 complex      6626811 DNA repair and recombination proteins [BR:dvi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6626811     TCR (transcription coupled repair) factors      Cul4-CSA complex       6626811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD Motif Other DBs NCBI-GeneID:  6626811 NCBI-ProteinID:  XP_002050928 UniProt:  B4LN06 LinkDB All DBs Position 5:complement(6709185..6709761) Genome browser AA seq 117 aa AA seqDB search MSAADNNEKPTTSTAAAAASATGGGMDRKRFNVKKWNGVALWSWDIVVDNCAICRNHIMD PCIQCQANQSSNSGIECTVAWGSCNHAFHFHCISHWLKTRPVCPLDNLEWNFEKYGR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgagcgccgcagataacaatgagaagccaacaaccagcacggcagccgccgccgcttca gccacgggcggcggcatggatcgtaagcgctttaatgtcaagaaatggaacggggtcgca ctctggtcctgggacattgtcgttgacaactgcgccatttgtcgcaatcacattatggat ccgtgtatccagtgccaggcgaatcagtctagcaacagcggcatcgagtgcaccgtcgcc tggggctcatgcaatcatgcctttcacttccactgcatatcgcattggctgaagacacgt cccgtctgtccgctggacaatctcgagtggaactttgagaaatatggtcgctag

DBGET integrated database retrieval system