Drosophila virilis: 6632744 Help Entry 6632744           CDS       T01066                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism dvi  Drosophila virilis Pathway dvi03008   Ribosome biogenesis in eukaryotes dvi03013   Nucleocytoplasmic transport dvi03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:dvi00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     6632744    03008 Ribosome biogenesis in eukaryotes     6632744   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     6632744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dvi03019]     6632744    03009 Ribosome biogenesis [BR:dvi03009]     6632744    03016 Transfer RNA biogenesis [BR:dvi03016]     6632744    03036 Chromosome and associated proteins [BR:dvi03036]     6632744   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dvi04147]     6632744    04031 GTP-binding proteins [BR:dvi04031]     6632744 Messenger RNA biogenesis [BR:dvi03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      6632744 Ribosome biogenesis [BR:dvi03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     6632744   Pre-60S particles     6632744 Transfer RNA biogenesis [BR:dvi03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     6632744 Chromosome and associated proteins [BR:dvi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      6632744    Spindle formation proteins     6632744 Exosome [BR:dvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6632744 GTP-binding proteins [BR:dvi04031]  Small (monomeric) G-proteins   Ran Family    Ran     6632744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA Pox_A32 AAA_24 AAA_7 DUF815 MMR_HSR1_Xtn AAA_22 AAA_33 Motif Other DBs NCBI-GeneID:  6632744 NCBI-ProteinID:  XP_002056459 UniProt:  B4M4L0 LinkDB All DBs Position 2:30417369..30418644 Genome browser AA seq 216 aa AA seqDB search MAYDCGDAIPSFKLVLVGDGGTGKTTFVKRHMTGEYQKRYLATMGVEVHPLKFHTSRGPV QFHVWDTAGQEKFGGLREGYYIQAQCAIIFFDVTSRTTYKNVPNWYRDLMRTCGHIPIVL CGNKIDIKDCKVKPKGLDFHRKKNIQYFPISAKSNYNFEKPFRWLARVLVGDPRLEFVEM PALQPPDVRMAKSWQLKMEHELAQAGLLLEDDDENL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcttatgattgtggtgatgcaataccatcttttaagctggtgctggttggcgatgga ggcacgggaaagacaacatttgtcaaacgtcacatgaccggcgagtatcagaagcgatat ttggccaccatgggagtggaggtgcatccattgaaatttcacacgagtcgcggaccagta caattccatgtctgggatacggccgggcaggaaaaatttggggggctgcgcgagggctat tacattcaggcgcaatgtgccattatcttctttgatgtgacctctcggaccacctataag aatgtgcccaactggtatcgggatttgatgcgtacctgcggccacataccaattgttctg tgcggaaataagattgacattaaggactgcaaggtcaagccaaagggtttggatttccat cgcaagaaaaatatacagtactttccgatatctgcgaaatcaaattataattttgagaaa ccttttcgctggctggctcgggtgctggttggtgatcctcgtctagagtttgtagagatg cctgcattgcagccgccggacgtgcgcatggccaaaagctggcaactgaaaatggagcac gaactggcacaggcgggtcttttacttgaggatgacgatgagaatttatag

DBGET integrated database retrieval system