Drosophila virilis: 6635721 Help Entry 6635721           CDS       T01066                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dvi  Drosophila virilis Pathway dvi03420   Nucleotide excision repair dvi04120   Ubiquitin mediated proteolysis dvi04141   Protein processing in endoplasmic reticulum dvi04310   Wnt signaling pathway dvi04341   Hedgehog signaling pathway - fly dvi04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dvi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6635721    04120 Ubiquitin mediated proteolysis     6635721   09124 Replication and repair    03420 Nucleotide excision repair     6635721  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6635721    04341 Hedgehog signaling pathway - fly     6635721    04350 TGF-beta signaling pathway     6635721  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dvi04121]     6635721    03400 DNA repair and recombination proteins [BR:dvi03400]     6635721 Enzymes [BR:dvi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6635721 Ubiquitin system [BR:dvi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6635721   Multi subunit type E3    SCF complex     Ring finger protein      6635721    Cul2 complex      6635721    Cul3 complex      6635721    Cul4 complex      6635721    Cul7 complex      6635721    Cul8 complex      6635721    Cul9 complex      6635721 DNA repair and recombination proteins [BR:dvi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6635721     TCR (transcription coupled repair) factors      Cul4-CSA complex       6635721 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 Motif Other DBs NCBI-GeneID:  6635721 NCBI-ProteinID:  XP_002059158 UniProt:  B4MDF5 LinkDB All DBs Position 4:858917..859783 Genome browser AA seq 149 aa AA seqDB search MEDTSESSCSALHTAETDSEHQTPSQSEANAMETEEQEEHEELDEQEEKPMCSADSQKSK KRFTVKKWNAVAMWAWDIAVDTCAICRNSIMDLCIECQADPNQNSFEECTVAWGVCNHAY HFHCISRWLKSRSVCPLDNREWEFQKLGR NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggaagacacaagcgaatcgagttgctctgcactccacacagcagagacggacagcgaa catcagacgccgagtcagagcgaggcgaatgcgatggaaaccgaggagcaggaggagcac gaggagctggacgagcaggaggagaagccgatgtgcagtgccgacagccagaagagcaag aagcgatttacggtcaagaaatggaatgcggtggccatgtgggcctgggatattgctgtg gacacttgcgcgatttgccgcaattccataatggatctttgcatcgaatgccaggccgat ccgaatcagaattccttcgaggagtgcaccgtcgcctggggtgtctgtaaccatgcctac catttccattgcatctcacgctggctcaagtcccgctccgtctgcccgctggacaaccgc gagtgggagttccagaagctgggccgctag

DBGET integrated database retrieval system