Drosophila willistoni: 6638312 Help Entry 6638312           CDS       T01067                                  Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism dwi  Drosophila willistoni Pathway dwi03030   DNA replication dwi03410   Base excision repair dwi03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dwi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     6638312    03410 Base excision repair     6638312    03420 Nucleotide excision repair     6638312  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dwi03032]     6638312    03400 DNA repair and recombination proteins [BR:dwi03400]     6638312 Enzymes [BR:dwi01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      6638312 DNA replication proteins [BR:dwi03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     6638312 DNA repair and recombination proteins [BR:dwi03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       6638312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C LonB_AAA-LID CENP-S TFIID-31kDa TAF Motif Other DBs NCBI-GeneID:  6638312 NCBI-ProteinID:  XP_002061264 UniProt:  B4MJG1 LinkDB All DBs Position 2L Genome browser AA seq 146 aa AA seqDB search MASEELFPNDHTEELDLEQELNEIADKSTEETPHEQGEKENSPAAAEDKSVATKTPAEPA EHEAKLCQLPIARIRNIMKLDPDLHVASNEAVFAVAKAVELFIESLARESYTYTAQAKKK TIQKRDVDLAISAVDSLMFLDGAMNF NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggctagcgaagaattatttccaaatgaccacacagaggagttagatttagagcaggaa ctaaatgaaatagctgacaaatcaacagaagaaacgccacatgaacaaggagaaaaggaa aattcacctgcagctgctgaagataaatctgttgccaccaaaacacctgctgaacccgcg gaacatgaggcaaaactctgtcaattacccattgctcgtataagaaacattatgaaattg gatccagatttacatgtggcctccaatgaggcagtctttgcagtagccaaagcagtggag ctttttatcgaatctttagctcgtgaatcctatacatatacagcacaagctaaaaagaaa accatacaaaaacgtgatgttgatctggccatatcggcagtggatagtcttatgtttttg gatggagctatgaatttttaa

DBGET integrated database retrieval system