Drosophila yakuba: Dyak_GE17622 Help Entry Dyak_GE17622      CDS       T01068                                  Name (GenBank) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dya  Drosophila yakuba Pathway dya03420   Nucleotide excision repair dya04120   Ubiquitin mediated proteolysis dya04141   Protein processing in endoplasmic reticulum dya04310   Wnt signaling pathway dya04341   Hedgehog signaling pathway - fly dya04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dya00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dyak_GE17622    04120 Ubiquitin mediated proteolysis     Dyak_GE17622   09124 Replication and repair    03420 Nucleotide excision repair     Dyak_GE17622  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dyak_GE17622    04341 Hedgehog signaling pathway - fly     Dyak_GE17622    04350 TGF-beta signaling pathway     Dyak_GE17622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dya04121]     Dyak_GE17622    03400 DNA repair and recombination proteins [BR:dya03400]     Dyak_GE17622 Enzymes [BR:dya01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      Dyak_GE17622 Ubiquitin system [BR:dya04121]  Ubiquitin ligases (E3)   UBL E3 ligases    Dyak_GE17622   Multi subunit type E3    SCF complex     Ring finger protein      Dyak_GE17622    Cul2 complex      Dyak_GE17622    Cul3 complex      Dyak_GE17622    Cul4 complex      Dyak_GE17622    Cul7 complex      Dyak_GE17622    Cul8 complex      Dyak_GE17622    Cul9 complex      Dyak_GE17622 DNA repair and recombination proteins [BR:dya03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       Dyak_GE17622     TCR (transcription coupled repair) factors      Cul4-CSA complex       Dyak_GE17622 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_UBOX zf-RING_16 PHD_NSD Motif Other DBs NCBI-ProteinID:  EDX02526 UniProt:  B4Q1V1 LinkDB All DBs Position X Genome browser AA seq 137 aa AA seqDB search MSEKKEVEEKEVEEKEVEEKEVEEAEDFHDMDFNDKEPSCSGAAGPARTERFVVKKWVAR AIWAWDVAVDNCAICRNHIMNLCIECQADPNANHDECTVAWGECNHAFHHHCIARWLKTR LVCPLDNKEWVYQKYGH NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgtccgagaagaaggaggttgaggagaaagaggttgaggagaaggaggttgaggagaaa gaggttgaggaggcggaggacttccatgacatggacttcaatgacaaggagccatcctgt agtggagcagctggcccagccaggacggagcgctttgtggtaaagaagtgggtggcacgc gccatttgggcatgggacgtagcggtggacaactgtgccatctgccgtaaccacatcatg aacctgtgcatcgagtgccaggcggatccgaatgcaaaccacgacgagtgcaccgtggct tggggcgagtgcaaccacgcattccatcatcactgcatcgcgcgctggctgaagacgcgc ctggtctgcccgctggacaacaaggagtgggtgtaccagaagtacggccactaa

DBGET integrated database retrieval system