Durio zibethinus (durian): 111303110 Help Entry 111303110         CDS       T05242                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism dzi  Durio zibethinus (durian) Pathway dzi00510   N-Glycan biosynthesis dzi00513   Various types of N-glycan biosynthesis dzi04141   Protein processing in endoplasmic reticulum Module dzi_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dzi00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111303110    00513 Various types of N-glycan biosynthesis     111303110  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111303110 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF7536 YLATT Motif Other DBs NCBI-GeneID:  111303110 NCBI-ProteinID:  XP_022754888 UniProt:  A0A6P5ZPS9 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MAPPAKAITSPVPDAWYPTLAVVMLAIGLVVTASFFIYEATSSKRNRSLAKELITGGVAS VFLGFGSLFLLLSAGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctcctcctgcaaaagcaataacgagtccagtgccagatgcgtggtacccaacccta gccgtcgtcatgctcgccattggccttgtcgtcacggcttcattcttcatctatgaagca acttcttccaagcgaaatcggtctcttgccaaggagctcatcactggaggagtggcatct gtcttcctgggctttgggtcattgtttctgctactttcagctggtgtttatgtctga

DBGET integrated database retrieval system