Ensifer adhaerens Casida A: FA04_07830 Help Entry FA04_07830        CDS       T04507                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism eah  Ensifer adhaerens Casida A Pathway eah00790   Folate biosynthesis eah01100   Metabolic pathways eah01240   Biosynthesis of cofactors Module eah_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:eah00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FA04_07830 Enzymes [BR:eah01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      FA04_07830  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      FA04_07830  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      FA04_07830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ANK72541 UniProt:  A0A9Q8Y956 LinkDB All DBs Position complement(1637887..1638255) Genome browser AA seq 122 aa AA seqDB search MSATYIITLKNCAFFARHGVFDEEELLGQRFFVDAELEVEQGTALVDDSIEDTVHYGIAF QEIERIVTGRRRYLIEALALEVAKTLCVRFPQIKRAKVSIRKPNAPVPGVLDYVEVTVEH VV NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgacctatatcatcaccctcaagaactgcgccttcttcgcgcgccacggcgtc ttcgacgaggaggagcttcttggtcagcgcttcttcgtcgatgccgagctcgaagtcgaa cagggaacggcgctggtcgacgactcgatcgaagacaccgtgcattacggcatcgccttc caggagatcgagcgcatcgtcaccggccgccgccgctatctgatcgaggcgctggcgctg gaagtggccaagacgctctgcgtgcgcttcccgcagatcaagcgcgccaaggtgtcgatc cgtaagccgaatgcgccggttccgggtgtgctcgattatgtcgaagtgacggtcgagcat gtcgtctga

DBGET integrated database retrieval system