Equus asinus (ass): 106835131 Help Entry 106835131         CDS       T04645                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism eai  Equus asinus (ass) Pathway eai03030   DNA replication eai03410   Base excision repair eai03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:eai00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     106835131 (POLE4)    03410 Base excision repair     106835131 (POLE4)    03420 Nucleotide excision repair     106835131 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eai03032]     106835131 (POLE4)    03400 DNA repair and recombination proteins [BR:eai03400]     106835131 (POLE4) Enzymes [BR:eai01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      106835131 (POLE4) DNA replication proteins [BR:eai03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     106835131 (POLE4) DNA repair and recombination proteins [BR:eai03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       106835131 (POLE4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  106835131 NCBI-ProteinID:  XP_014702764 UniProt:  A0A9L0K0J3 LinkDB All DBs Position 6:64666632..64675095 Genome browser AA seq 116 aa AA seqDB search MAAAAAGSGTPREEEGPGGEAVAPPPQAPTGAPGARLSRLPLARVKALVKADPDVTLAGQ EAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggctggaagcggaacgccccgggaggaggaggggcccggtggggag gcagtggcccctccgccccaagccccgacgggtgcgcccggggctcgtctctcgaggctg cctctggcgcgagtgaaggccttggtgaaggcggaccccgacgtgacgctcgcgggacag gaagccatcttcattctggcacgagctgcggaactgtttgtggagaccattgcaaaagat gcctactgctgtgcccaacaagggaagaggaaaaccctgcagaggagagatttggataat gcaatagaagctgtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system