Equus asinus (ass): 106841015 Help Entry 106841015         CDS       T04645                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X2   KO K05430   interleukin 4 Organism eai  Equus asinus (ass) Pathway eai04060   Cytokine-cytokine receptor interaction eai04151   PI3K-Akt signaling pathway eai04630   JAK-STAT signaling pathway eai04640   Hematopoietic cell lineage eai04657   IL-17 signaling pathway eai04658   Th1 and Th2 cell differentiation eai04659   Th17 cell differentiation eai04660   T cell receptor signaling pathway eai04664   Fc epsilon RI signaling pathway eai04672   Intestinal immune network for IgA production eai05140   Leishmaniasis eai05200   Pathways in cancer eai05310   Asthma eai05320   Autoimmune thyroid disease eai05321   Inflammatory bowel disease eai05330   Allograft rejection Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     106841015 (IL4)    04151 PI3K-Akt signaling pathway     106841015 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106841015 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     106841015 (IL4)    04660 T cell receptor signaling pathway     106841015 (IL4)    04658 Th1 and Th2 cell differentiation     106841015 (IL4)    04659 Th17 cell differentiation     106841015 (IL4)    04657 IL-17 signaling pathway     106841015 (IL4)    04664 Fc epsilon RI signaling pathway     106841015 (IL4)    04672 Intestinal immune network for IgA production     106841015 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106841015 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     106841015 (IL4)   09163 Immune disease    05310 Asthma     106841015 (IL4)    05320 Autoimmune thyroid disease     106841015 (IL4)    05321 Inflammatory bowel disease     106841015 (IL4)    05330 Allograft rejection     106841015 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106841015 (IL4)    00536 Glycosaminoglycan binding proteins [BR:eai00536]     106841015 (IL4) Cytokines and neuropeptides [BR:eai04052]  Cytokines   Interleukins    106841015 (IL4) Glycosaminoglycan binding proteins [BR:eai00536]  Heparan sulfate / Heparin   Cytokines    106841015 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Tugs Motif Other DBs NCBI-GeneID:  106841015 NCBI-ProteinID:  XP_014712257 LinkDB All DBs Position 12:11347575..11358367 Genome browser AA seq 139 aa AA seqDB search MGLISQLIPALVCLLACTSNFIQGCKYDITLQEIIKTLNNLTDGKGKNSCMELTVADAFA GPKNTDGKEICRAAKVLQQLYKRHDRSLIKECLSGLDRNLKGMANGTCCTVNEAKKSTLK DFLERLKTIMKEKYSKCQS NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgggtctcatctcccaactgattccagctctggtctgcttactagcatgtaccagcaac ttcatccagggatgcaaatacgacatcaccttacaagagatcatcaaaacgctgaacaac ctcacagatggaaagggcaagaattcgtgcatggagctgactgtagcggatgcctttgct ggcccaaagaacacagatggaaaggaaatctgcagggctgcaaaggtgcttcaacagctc tataaaagacatgacaggtccttgatcaaagaatgcctgagcggactggacaggaacctc aagggcatggcaaacgggacctgctgtactgtgaatgaagccaagaagagtacattgaaa gactttttggaaaggctaaagacaatcatgaaagagaaatactcaaagtgtcaaagctga

DBGET integrated database retrieval system