Equus asinus (ass): 106843586 Help Entry 106843586         CDS       T04645                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism eai  Equus asinus (ass) Pathway eai04010   MAPK signaling pathway eai04014   Ras signaling pathway eai04015   Rap1 signaling pathway eai04024   cAMP signaling pathway eai04062   Chemokine signaling pathway eai04510   Focal adhesion eai04520   Adherens junction eai04611   Platelet activation eai04670   Leukocyte transendothelial migration eai04720   Long-term potentiation eai04722   Neurotrophin signaling pathway eai04934   Cushing syndrome eai04972   Pancreatic secretion eai05211   Renal cell carcinoma eai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106843586 (RAP1B)    04014 Ras signaling pathway     106843586 (RAP1B)    04015 Rap1 signaling pathway     106843586 (RAP1B)    04024 cAMP signaling pathway     106843586 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     106843586 (RAP1B)    04520 Adherens junction     106843586 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     106843586 (RAP1B)    04670 Leukocyte transendothelial migration     106843586 (RAP1B)    04062 Chemokine signaling pathway     106843586 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     106843586 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     106843586 (RAP1B)    04722 Neurotrophin signaling pathway     106843586 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     106843586 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106843586 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     106843586 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106843586 (RAP1B)    04031 GTP-binding proteins [BR:eai04031]     106843586 (RAP1B) Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106843586 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    106843586 (RAP1B)   Exosomal proteins of colorectal cancer cells    106843586 (RAP1B) GTP-binding proteins [BR:eai04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     106843586 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  106843586 NCBI-ProteinID:  XP_014716171 UniProt:  A0A9L0IZ97 LinkDB All DBs Position 22:complement(2358257..2400742) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CRLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctggtcgttctcggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacaatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcctggatactgcggga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttgcaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgaggcaaattaacagaaaaactcctgtgcctgggaaggcccgcaaaaagtcgtcg tgtcggctgctttaa

DBGET integrated database retrieval system