Equus asinus (ass): 106844507 Help Entry 106844507         CDS       T04645                                  Symbol CD209 Name (RefSeq) CD209 antigen isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism eai  Equus asinus (ass) Pathway eai03260   Virion - Human immunodeficiency virus eai03264   Virion - Flavivirus and Alphavirus eai03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus eai03273   Virion - Lassa virus and SFTS virus eai04145   Phagosome eai04625   C-type lectin receptor signaling pathway eai05152   Tuberculosis eai05162   Measles Brite KEGG Orthology (KO) [BR:eai00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     106844507 (CD209)    03264 Virion - Flavivirus and Alphavirus     106844507 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     106844507 (CD209)    03273 Virion - Lassa virus and SFTS virus     106844507 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106844507 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106844507 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     106844507 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     106844507 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106844507 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:eai04054]     106844507 (CD209)    04090 CD molecules [BR:eai04090]     106844507 (CD209)    04091 Lectins [BR:eai04091]     106844507 (CD209) Membrane trafficking [BR:eai04131]  Endocytosis   Phagocytosis    C-lectin receptors     106844507 (CD209) Pattern recognition receptors [BR:eai04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    106844507 (CD209) CD molecules [BR:eai04090]  Proteins   106844507 (CD209) Lectins [BR:eai04091]  C-Type lectins   Asialoglycoprotein and DC receptors    106844507 (CD209) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C UL45 Motif Other DBs NCBI-GeneID:  106844507 NCBI-ProteinID:  XP_014717459 UniProt:  A0A8C4L8L6 LinkDB All DBs Position 20:complement(5597342..5601291) Genome browser AA seq 238 aa AA seqDB search MDQRDPKEPMALDEEELMTSGNRLSSKDFGFQKSHGFKNFPGCQGQGRAPLVLLFLSLVV FAGLLVAILVQVSKVPRSQGLEPSKQEEIQQILTQLKAGIALLCHPCPWGWRSFQGNCYF FSNSQLNWHDSVTACEEVEAQLVVIESAEEQNFLQVQASRFNRLTWMGLSDLKHEGTWHW VDGSPLLPSFMKYWNEGEPNSSGEEDCAEFRGKGWNDSKCSLSKFWICKKPTTSCSSA NT seq 717 nt NT seq  +upstreamnt  +downstreamnt atggaccagcgtgaccccaaggaaccgatggcactggatgaggaagagctgatgaccagt gggaacagactttcctccaaagactttggattccaaaagagtcatggcttcaagaacttc ccagggtgtcaggggcagggccgggcccccctggtgctcctgttcctctccctcgtggtc ttcgctgggctcctggtggccatcctagtccaagtctccaaggtccccaggtcccagggg ctggagccttcgaagcaggaggagatccagcaaatactgacccagctgaaggctggaatc gcccttctgtgccacccctgtccctggggctggcggtccttccaaggaaactgctacttc ttctccaactcgcaactcaactggcacgactccgtgactgcctgtgaggaagtggaggct caactagtagtcatcgaaagcgctgaggagcagaacttcctgcaggtccaggcttccagg tttaaccgcttgacctggatggggctctcagacctgaaacacgaaggcacgtggcactgg gtggacggttctcccctgctgcccagcttcatgaagtattggaatgaaggagagcccaac agcagtggggaggaagactgcgcggagtttaggggcaaaggctggaacgactccaaatgc agcctcagcaaattctggatttgcaaaaagcccacaacctcgtgctccagtgcctaa

DBGET integrated database retrieval system