Equus asinus (ass): 123284554 Help Entry 123284554         CDS       T04645                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism eai  Equus asinus (ass) Pathway eai01521   EGFR tyrosine kinase inhibitor resistance eai04010   MAPK signaling pathway eai04014   Ras signaling pathway eai04015   Rap1 signaling pathway eai04020   Calcium signaling pathway eai04151   PI3K-Akt signaling pathway eai04550   Signaling pathways regulating pluripotency of stem cells eai04810   Regulation of actin cytoskeleton eai05167   Kaposi sarcoma-associated herpesvirus infection eai05200   Pathways in cancer eai05205   Proteoglycans in cancer eai05207   Chemical carcinogenesis - receptor activation eai05218   Melanoma eai05224   Breast cancer eai05226   Gastric cancer Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123284554 (FGF2)    04014 Ras signaling pathway     123284554 (FGF2)    04015 Rap1 signaling pathway     123284554 (FGF2)    04020 Calcium signaling pathway     123284554 (FGF2)    04151 PI3K-Akt signaling pathway     123284554 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     123284554 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     123284554 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123284554 (FGF2)    05205 Proteoglycans in cancer     123284554 (FGF2)    05207 Chemical carcinogenesis - receptor activation     123284554 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     123284554 (FGF2)    05218 Melanoma     123284554 (FGF2)    05224 Breast cancer     123284554 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     123284554 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     123284554 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     123284554 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:eai00536]     123284554 (FGF2) Cytokines and neuropeptides [BR:eai04052]  Cytokines   Growth factors (RTK binding)    123284554 (FGF2) Glycosaminoglycan binding proteins [BR:eai00536]  Heparan sulfate / Heparin   Growth factors/receptors    123284554 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  123284554 NCBI-ProteinID:  XP_044623204 LinkDB All DBs Position 3:complement(56872557..56929801) Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgcccgaggacggcggcagcggcgcc ttcccgcccggccacttcaaggaccccaagcggctctactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgggagaagagcgaccctcacatc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttatcttgctatgaaggaagatggaaggttactggcttctaaatgtgttacggacgag tgtttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggccctgaaacgaacggggcagtataaacttggacccaaaacagga cctggacagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system